Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H2AP82

Protein Details
Accession H2AP82    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
89-114VEDLTKQKIKIKRRFRRNKATGEKELHydrophilic
193-236EEEPKKESVKKVKQEAKKEKKSTPQEKKSPDKKGLMKKVKKIFNBasic
NLS Segment(s)
PositionSequence
96-107KIKIKRRFRRNK
190-234KAKEEEPKKESVKKVKQEAKKEKKSTPQEKKSPDKKGLMKKVKKI
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032640  AMPK1_CBM  
IPR013783  Ig-like_fold  
IPR014756  Ig_E-set  
KEGG kaf:KAFR_0A07480  -  
Pfam View protein in Pfam  
PF16561  AMPK1_CBM  
CDD cd02859  E_set_AMPKbeta_like_N  
Amino Acid Sequences MSKCIYKFNWCGSAGEVILTGTFDNWGQSITLDKINDELFSKKLEFPKEKAALDGKIFFKFIVDGEWKTSGNYNVETDDKGNLNNFLLVEDLTKQKIKIKRRFRRNKATGEKELLVTETYRLDEDDNVVELIESIDHLKLQKDKESGSNNDGSVRIAELYEIKYDDESDQSSDDNNSGLVKEPKVVNENKAKEEEPKKESVKKVKQEAKKEKKSTPQEKKSPDKKGLMKKVKKIFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.28
3 0.21
4 0.14
5 0.13
6 0.12
7 0.1
8 0.06
9 0.07
10 0.06
11 0.07
12 0.07
13 0.07
14 0.07
15 0.07
16 0.1
17 0.12
18 0.16
19 0.15
20 0.15
21 0.17
22 0.17
23 0.18
24 0.17
25 0.17
26 0.14
27 0.17
28 0.19
29 0.22
30 0.27
31 0.34
32 0.37
33 0.39
34 0.48
35 0.5
36 0.48
37 0.47
38 0.45
39 0.4
40 0.38
41 0.4
42 0.32
43 0.27
44 0.27
45 0.23
46 0.2
47 0.17
48 0.15
49 0.14
50 0.15
51 0.14
52 0.17
53 0.19
54 0.19
55 0.19
56 0.21
57 0.19
58 0.18
59 0.19
60 0.17
61 0.17
62 0.18
63 0.18
64 0.17
65 0.16
66 0.15
67 0.14
68 0.14
69 0.13
70 0.12
71 0.12
72 0.11
73 0.08
74 0.08
75 0.07
76 0.07
77 0.08
78 0.09
79 0.1
80 0.11
81 0.11
82 0.17
83 0.24
84 0.34
85 0.42
86 0.52
87 0.6
88 0.7
89 0.81
90 0.84
91 0.89
92 0.86
93 0.87
94 0.86
95 0.83
96 0.76
97 0.69
98 0.61
99 0.5
100 0.42
101 0.32
102 0.23
103 0.15
104 0.12
105 0.08
106 0.07
107 0.07
108 0.07
109 0.07
110 0.07
111 0.08
112 0.07
113 0.07
114 0.07
115 0.07
116 0.06
117 0.06
118 0.05
119 0.04
120 0.04
121 0.04
122 0.04
123 0.05
124 0.05
125 0.07
126 0.11
127 0.13
128 0.18
129 0.19
130 0.2
131 0.26
132 0.31
133 0.33
134 0.33
135 0.34
136 0.29
137 0.29
138 0.28
139 0.22
140 0.16
141 0.14
142 0.1
143 0.07
144 0.08
145 0.08
146 0.09
147 0.09
148 0.1
149 0.09
150 0.09
151 0.1
152 0.11
153 0.11
154 0.11
155 0.11
156 0.11
157 0.11
158 0.12
159 0.11
160 0.11
161 0.09
162 0.08
163 0.08
164 0.07
165 0.12
166 0.14
167 0.14
168 0.17
169 0.18
170 0.21
171 0.27
172 0.29
173 0.31
174 0.38
175 0.42
176 0.42
177 0.44
178 0.42
179 0.45
180 0.51
181 0.52
182 0.47
183 0.51
184 0.54
185 0.58
186 0.65
187 0.67
188 0.69
189 0.7
190 0.76
191 0.77
192 0.8
193 0.83
194 0.86
195 0.86
196 0.87
197 0.85
198 0.83
199 0.84
200 0.86
201 0.87
202 0.86
203 0.86
204 0.85
205 0.87
206 0.91
207 0.9
208 0.89
209 0.86
210 0.84
211 0.83
212 0.84
213 0.86
214 0.86
215 0.85
216 0.85