Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4TBN3

Protein Details
Accession A0A1E4TBN3    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-24RLTLRTRKSYNTKSNNVKVVKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
Amino Acid Sequences MAQRLTLRTRKSYNTKSNNVKVVKTPGGKLRYLRVKKAAGRPRCGDCGIPLPGIAAVRPRKYSKLSKTKKTVQRAYGGSRCATCVREKIIRSFLLDENRIAKRLAKNNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.77
3 0.8
4 0.81
5 0.81
6 0.74
7 0.66
8 0.6
9 0.57
10 0.55
11 0.48
12 0.44
13 0.43
14 0.44
15 0.45
16 0.42
17 0.43
18 0.46
19 0.48
20 0.49
21 0.48
22 0.51
23 0.54
24 0.63
25 0.63
26 0.6
27 0.62
28 0.61
29 0.58
30 0.55
31 0.5
32 0.4
33 0.33
34 0.31
35 0.26
36 0.22
37 0.18
38 0.14
39 0.14
40 0.13
41 0.11
42 0.12
43 0.14
44 0.15
45 0.19
46 0.2
47 0.23
48 0.28
49 0.37
50 0.41
51 0.49
52 0.56
53 0.62
54 0.68
55 0.75
56 0.78
57 0.79
58 0.77
59 0.7
60 0.69
61 0.65
62 0.64
63 0.59
64 0.53
65 0.45
66 0.37
67 0.35
68 0.3
69 0.28
70 0.24
71 0.23
72 0.26
73 0.32
74 0.34
75 0.37
76 0.41
77 0.4
78 0.4
79 0.41
80 0.4
81 0.41
82 0.4
83 0.37
84 0.37
85 0.37
86 0.35
87 0.32
88 0.33
89 0.35