Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TEH7

Protein Details
Accession A0A1E4TEH7   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
49-70AFIKRLKGIKKRKKGSNLPNVIHydrophilic
NLS Segment(s)
PositionSequence
52-63KRLKGIKKRKKG
85-92KRKRWIKK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019340  Histone_AcTrfase_su3  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF10198  Ada3  
Amino Acid Sequences MKQLQESLRIYTAANNARKKRLRPLVEEHMAYQEYLSILDDLDKQVDQAFIKRLKGIKKRKKGSNLPNVIQQTSSAESSRALLEKRKRWIKKIGPAFAPPEIMKRVPSESIFQDLAVEDERTGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.48
4 0.57
5 0.63
6 0.63
7 0.66
8 0.68
9 0.66
10 0.65
11 0.68
12 0.68
13 0.68
14 0.64
15 0.55
16 0.48
17 0.42
18 0.35
19 0.26
20 0.17
21 0.11
22 0.1
23 0.1
24 0.06
25 0.06
26 0.07
27 0.08
28 0.07
29 0.08
30 0.08
31 0.07
32 0.08
33 0.1
34 0.09
35 0.1
36 0.15
37 0.17
38 0.17
39 0.2
40 0.23
41 0.3
42 0.39
43 0.48
44 0.53
45 0.61
46 0.69
47 0.74
48 0.8
49 0.81
50 0.81
51 0.81
52 0.78
53 0.69
54 0.67
55 0.61
56 0.52
57 0.42
58 0.32
59 0.24
60 0.19
61 0.18
62 0.12
63 0.11
64 0.11
65 0.12
66 0.13
67 0.12
68 0.12
69 0.18
70 0.26
71 0.32
72 0.41
73 0.5
74 0.54
75 0.57
76 0.67
77 0.68
78 0.7
79 0.74
80 0.71
81 0.65
82 0.64
83 0.62
84 0.53
85 0.47
86 0.38
87 0.32
88 0.29
89 0.26
90 0.24
91 0.24
92 0.25
93 0.25
94 0.27
95 0.27
96 0.26
97 0.3
98 0.29
99 0.26
100 0.24
101 0.2
102 0.2
103 0.18
104 0.16