Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4TKF6

Protein Details
Accession A0A1E4TKF6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
15-41AAQSSSKKSKKKWSKGKVKDKAQHTPLHydrophilic
NLS Segment(s)
PositionSequence
19-35SSKKSKKKWSKGKVKDK
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAPQATKAAKLAAAQSSSKKSKKKWSKGKVKDKAQHTPLLDQTLYDRLIKDASTSKLVTVSVLVDRLKINGSLARRALRELEAQGVIRPVINHSKQQTYTRASAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.25
4 0.26
5 0.32
6 0.38
7 0.44
8 0.47
9 0.49
10 0.58
11 0.67
12 0.73
13 0.77
14 0.8
15 0.85
16 0.89
17 0.94
18 0.93
19 0.92
20 0.89
21 0.84
22 0.83
23 0.75
24 0.7
25 0.6
26 0.54
27 0.46
28 0.42
29 0.35
30 0.25
31 0.23
32 0.2
33 0.19
34 0.16
35 0.14
36 0.11
37 0.11
38 0.11
39 0.11
40 0.12
41 0.12
42 0.15
43 0.15
44 0.14
45 0.15
46 0.15
47 0.13
48 0.1
49 0.09
50 0.07
51 0.09
52 0.09
53 0.09
54 0.09
55 0.1
56 0.11
57 0.1
58 0.1
59 0.12
60 0.14
61 0.17
62 0.2
63 0.23
64 0.22
65 0.23
66 0.24
67 0.23
68 0.24
69 0.21
70 0.21
71 0.2
72 0.2
73 0.2
74 0.19
75 0.16
76 0.14
77 0.13
78 0.14
79 0.22
80 0.24
81 0.3
82 0.33
83 0.41
84 0.44
85 0.5
86 0.53
87 0.5