Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PIJ0

Protein Details
Accession A0A1E3PIJ0   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-31GVSNTGKIRKPPAKRAKSPPLLPDQHydrophilic
NLS Segment(s)
PositionSequence
13-23KIRKPPAKRAK
Subcellular Location(s) mito_nucl 12.666, nucl 12.5, mito 12.5, cyto_nucl 7.833, cyto_mito 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR018865  Ser/Thr_kinase_19  
Pfam View protein in Pfam  
PF10494  Stk19  
Amino Acid Sequences MVLHFTGVSNTGKIRKPPAKRAKSPPLLPDQIAFIKELEDETLRNQQAKKVDKLENISWKVHLEWEQSGISDITKSIKDITNSMWIDIPEKGLGANFKAEIFQYRQSLPPLVTNTQLHGLCYKNPTSVDRELLSAIESGIIRQLAISRHDNTGELVIPSEYFFDQIDKLKDQDGQDEATVQMLESYQDLCDDNPANISFRTDELNEYGIHAAHITFLVKSGFLTLCPGRSGLYNLTIPNLGMYVKLVTTARLWVLNTIKKSTWKELLESALTEKMEGSKQKWRDLRGLKMEWIMKDCHGGGWCEPFSTPVGRGWKLTGQKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.47
3 0.55
4 0.65
5 0.72
6 0.76
7 0.81
8 0.86
9 0.87
10 0.88
11 0.85
12 0.81
13 0.79
14 0.74
15 0.65
16 0.56
17 0.5
18 0.43
19 0.38
20 0.31
21 0.22
22 0.18
23 0.17
24 0.16
25 0.14
26 0.12
27 0.12
28 0.15
29 0.23
30 0.24
31 0.28
32 0.28
33 0.31
34 0.38
35 0.44
36 0.47
37 0.46
38 0.51
39 0.52
40 0.58
41 0.61
42 0.62
43 0.59
44 0.54
45 0.47
46 0.42
47 0.37
48 0.35
49 0.32
50 0.25
51 0.22
52 0.24
53 0.23
54 0.21
55 0.22
56 0.18
57 0.15
58 0.11
59 0.11
60 0.1
61 0.1
62 0.11
63 0.13
64 0.16
65 0.17
66 0.18
67 0.21
68 0.27
69 0.27
70 0.27
71 0.26
72 0.22
73 0.23
74 0.22
75 0.2
76 0.11
77 0.11
78 0.1
79 0.09
80 0.1
81 0.09
82 0.1
83 0.09
84 0.09
85 0.1
86 0.1
87 0.12
88 0.15
89 0.17
90 0.18
91 0.19
92 0.22
93 0.23
94 0.24
95 0.22
96 0.23
97 0.24
98 0.22
99 0.24
100 0.23
101 0.22
102 0.25
103 0.25
104 0.21
105 0.19
106 0.19
107 0.18
108 0.21
109 0.2
110 0.18
111 0.19
112 0.21
113 0.23
114 0.25
115 0.25
116 0.22
117 0.22
118 0.2
119 0.19
120 0.17
121 0.11
122 0.09
123 0.08
124 0.07
125 0.06
126 0.07
127 0.06
128 0.05
129 0.05
130 0.08
131 0.08
132 0.12
133 0.15
134 0.16
135 0.17
136 0.17
137 0.18
138 0.16
139 0.15
140 0.12
141 0.09
142 0.08
143 0.07
144 0.06
145 0.06
146 0.07
147 0.06
148 0.06
149 0.06
150 0.06
151 0.08
152 0.1
153 0.12
154 0.12
155 0.13
156 0.13
157 0.17
158 0.16
159 0.18
160 0.16
161 0.15
162 0.14
163 0.14
164 0.13
165 0.1
166 0.09
167 0.06
168 0.05
169 0.04
170 0.05
171 0.04
172 0.05
173 0.04
174 0.05
175 0.06
176 0.06
177 0.09
178 0.09
179 0.09
180 0.1
181 0.11
182 0.11
183 0.11
184 0.12
185 0.1
186 0.11
187 0.13
188 0.11
189 0.12
190 0.12
191 0.13
192 0.12
193 0.13
194 0.12
195 0.1
196 0.09
197 0.08
198 0.07
199 0.06
200 0.06
201 0.06
202 0.05
203 0.06
204 0.06
205 0.06
206 0.06
207 0.08
208 0.08
209 0.08
210 0.12
211 0.12
212 0.13
213 0.14
214 0.14
215 0.12
216 0.13
217 0.16
218 0.13
219 0.16
220 0.17
221 0.17
222 0.18
223 0.18
224 0.16
225 0.14
226 0.12
227 0.08
228 0.06
229 0.07
230 0.07
231 0.06
232 0.08
233 0.08
234 0.09
235 0.1
236 0.12
237 0.12
238 0.13
239 0.14
240 0.16
241 0.23
242 0.27
243 0.29
244 0.31
245 0.32
246 0.38
247 0.43
248 0.44
249 0.46
250 0.42
251 0.43
252 0.42
253 0.44
254 0.38
255 0.34
256 0.31
257 0.26
258 0.24
259 0.21
260 0.18
261 0.16
262 0.2
263 0.23
264 0.24
265 0.29
266 0.34
267 0.43
268 0.48
269 0.5
270 0.55
271 0.59
272 0.64
273 0.65
274 0.64
275 0.58
276 0.6
277 0.59
278 0.52
279 0.47
280 0.4
281 0.32
282 0.32
283 0.29
284 0.26
285 0.24
286 0.23
287 0.23
288 0.28
289 0.27
290 0.24
291 0.24
292 0.22
293 0.23
294 0.24
295 0.23
296 0.22
297 0.29
298 0.3
299 0.31
300 0.34
301 0.39