Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H2AS38

Protein Details
Accession H2AS38    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
9-31REEFRDLRKKCREIKIENRKLISBasic
114-137ISDERYKKGAQKRRRLKDTERGFIBasic
NLS Segment(s)
PositionSequence
120-130KKGAQKRRRLK
Subcellular Location(s) nucl 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR013260  mRNA_splic_SYF2  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
KEGG kaf:KAFR_0C01950  -  
Pfam View protein in Pfam  
PF08231  SYF2  
Amino Acid Sequences MEMDMANLREEFRDLRKKCREIKIENRKLISIASKPKTYSIREEEIGAEVSDEDEDDSEIIKLLTKPLREFETEAHVAENKEDIDRLTYNKEVMSLGKREKRDVESLVSEMNRISDERYKKGAQKRRRLKDTERGFINEQNKAFNLRLEKEKENGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.44
3 0.53
4 0.6
5 0.67
6 0.74
7 0.75
8 0.74
9 0.83
10 0.84
11 0.84
12 0.83
13 0.76
14 0.66
15 0.58
16 0.5
17 0.44
18 0.4
19 0.39
20 0.38
21 0.38
22 0.38
23 0.43
24 0.46
25 0.44
26 0.45
27 0.41
28 0.41
29 0.39
30 0.4
31 0.35
32 0.31
33 0.28
34 0.2
35 0.14
36 0.09
37 0.09
38 0.07
39 0.06
40 0.05
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.06
49 0.06
50 0.1
51 0.13
52 0.14
53 0.15
54 0.17
55 0.19
56 0.19
57 0.21
58 0.18
59 0.21
60 0.21
61 0.2
62 0.18
63 0.17
64 0.16
65 0.14
66 0.14
67 0.08
68 0.07
69 0.07
70 0.07
71 0.08
72 0.09
73 0.1
74 0.12
75 0.13
76 0.13
77 0.13
78 0.13
79 0.11
80 0.13
81 0.15
82 0.16
83 0.22
84 0.27
85 0.28
86 0.3
87 0.33
88 0.35
89 0.36
90 0.34
91 0.31
92 0.28
93 0.28
94 0.28
95 0.24
96 0.21
97 0.16
98 0.15
99 0.11
100 0.1
101 0.12
102 0.17
103 0.21
104 0.25
105 0.3
106 0.34
107 0.4
108 0.5
109 0.57
110 0.6
111 0.67
112 0.74
113 0.79
114 0.84
115 0.85
116 0.83
117 0.83
118 0.83
119 0.8
120 0.74
121 0.68
122 0.62
123 0.62
124 0.59
125 0.54
126 0.46
127 0.41
128 0.37
129 0.36
130 0.34
131 0.32
132 0.33
133 0.32
134 0.39
135 0.42
136 0.44
137 0.45