Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H2APQ7

Protein Details
Accession H2APQ7    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
48-67MTRTRRSTLRRAHKDRGKKFBasic
NLS Segment(s)
PositionSequence
61-61K
Subcellular Location(s) cyto_nucl 11.833, nucl 11, cyto 8.5, cyto_mito 8.332, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034751  Yippee  
IPR004910  Yippee/Mis18/Cereblon  
IPR039058  Yippee_fam  
Gene Ontology GO:0046872  F:metal ion binding  
KEGG kaf:KAFR_0B00580  -  
Pfam View protein in Pfam  
PF03226  Yippee-Mis18  
PROSITE View protein in PROSITE  
PS51792  YIPPEE  
Amino Acid Sequences MGIRFTSYIEPPASANNLHASFEPHFAVSSLNSRLLETADSGGSSMAMTRTRRSTLRRAHKDRGKKFITYGCRHCRTHLSSSVQIISKDYRGRTGDAYLMSSVLNVIEDKVETRSMLTGEYLVCDILCHLCKKLIGWKYLRSDNKDQNYKEGKYILELQEICKCH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.22
4 0.22
5 0.22
6 0.22
7 0.23
8 0.22
9 0.24
10 0.23
11 0.17
12 0.16
13 0.16
14 0.16
15 0.13
16 0.16
17 0.16
18 0.18
19 0.18
20 0.18
21 0.18
22 0.18
23 0.17
24 0.13
25 0.12
26 0.09
27 0.09
28 0.09
29 0.08
30 0.07
31 0.06
32 0.06
33 0.06
34 0.1
35 0.12
36 0.14
37 0.18
38 0.21
39 0.26
40 0.3
41 0.38
42 0.44
43 0.54
44 0.62
45 0.67
46 0.74
47 0.77
48 0.82
49 0.79
50 0.78
51 0.7
52 0.61
53 0.56
54 0.53
55 0.54
56 0.5
57 0.52
58 0.52
59 0.55
60 0.54
61 0.53
62 0.53
63 0.49
64 0.48
65 0.46
66 0.42
67 0.38
68 0.39
69 0.39
70 0.34
71 0.29
72 0.25
73 0.19
74 0.17
75 0.18
76 0.17
77 0.19
78 0.19
79 0.2
80 0.2
81 0.2
82 0.19
83 0.17
84 0.18
85 0.13
86 0.12
87 0.11
88 0.09
89 0.08
90 0.05
91 0.05
92 0.04
93 0.04
94 0.04
95 0.04
96 0.05
97 0.07
98 0.08
99 0.07
100 0.08
101 0.09
102 0.09
103 0.09
104 0.08
105 0.08
106 0.08
107 0.08
108 0.08
109 0.07
110 0.07
111 0.06
112 0.06
113 0.09
114 0.12
115 0.12
116 0.13
117 0.15
118 0.16
119 0.18
120 0.26
121 0.29
122 0.33
123 0.37
124 0.43
125 0.48
126 0.57
127 0.62
128 0.6
129 0.64
130 0.66
131 0.72
132 0.73
133 0.68
134 0.69
135 0.7
136 0.64
137 0.59
138 0.52
139 0.43
140 0.38
141 0.45
142 0.37
143 0.37
144 0.36
145 0.35