Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PKZ8

Protein Details
Accession A0A1E3PKZ8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
173-195AMNWLEKKLKKKDHAKGDWKEVVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 21.5, cyto_nucl 11.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029055  Ntn_hydrolases_N  
IPR023332  Proteasome_alpha-type  
IPR000426  Proteasome_asu_N  
IPR001353  Proteasome_sua/b  
IPR034642  Proteasome_subunit_alpha6  
Gene Ontology GO:0005634  C:nucleus  
GO:0019773  C:proteasome core complex, alpha-subunit complex  
GO:0034515  C:proteasome storage granule  
GO:0016787  F:hydrolase activity  
GO:0010499  P:proteasomal ubiquitin-independent protein catabolic process  
GO:0043161  P:proteasome-mediated ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF00227  Proteasome  
PF10584  Proteasome_A_N  
PROSITE View protein in PROSITE  
PS00388  PROTEASOME_ALPHA_1  
PS51475  PROTEASOME_ALPHA_2  
CDD cd03754  proteasome_alpha_type_6  
Amino Acid Sequences MSGSAGFDRHITIFSPEGRLYQVEYAFKAVTSVNITSIGIRGKDCAVVVSQKKVPDKLLDPESVSYIFKISPQVGAVLTGQIPDARAAVARARGEAAEFRYKYGYEMPCDVLAKRMANINQVYTQRAYMRPLGVCMTLISVDDEFGPQLYKCDPAGYYVGYKATSTGPKQQEAMNWLEKKLKKKDHAKGDWKEVVELAITALSSALSVDFRKGDIEIGVALKDQGFKKLSVEEIDERLVAIAEQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.24
3 0.22
4 0.23
5 0.23
6 0.23
7 0.22
8 0.23
9 0.25
10 0.22
11 0.23
12 0.25
13 0.23
14 0.22
15 0.2
16 0.16
17 0.14
18 0.16
19 0.15
20 0.13
21 0.14
22 0.15
23 0.14
24 0.16
25 0.16
26 0.14
27 0.13
28 0.14
29 0.14
30 0.15
31 0.14
32 0.13
33 0.13
34 0.2
35 0.22
36 0.26
37 0.28
38 0.32
39 0.35
40 0.36
41 0.37
42 0.34
43 0.36
44 0.37
45 0.38
46 0.35
47 0.33
48 0.32
49 0.31
50 0.27
51 0.24
52 0.17
53 0.14
54 0.12
55 0.11
56 0.13
57 0.12
58 0.11
59 0.11
60 0.12
61 0.11
62 0.12
63 0.11
64 0.09
65 0.09
66 0.08
67 0.07
68 0.07
69 0.07
70 0.06
71 0.06
72 0.05
73 0.05
74 0.06
75 0.08
76 0.12
77 0.11
78 0.11
79 0.12
80 0.11
81 0.12
82 0.13
83 0.15
84 0.19
85 0.19
86 0.2
87 0.2
88 0.2
89 0.21
90 0.25
91 0.24
92 0.18
93 0.2
94 0.2
95 0.2
96 0.21
97 0.2
98 0.16
99 0.16
100 0.14
101 0.13
102 0.15
103 0.14
104 0.18
105 0.18
106 0.17
107 0.19
108 0.2
109 0.21
110 0.18
111 0.18
112 0.16
113 0.17
114 0.17
115 0.15
116 0.17
117 0.15
118 0.16
119 0.16
120 0.14
121 0.13
122 0.11
123 0.09
124 0.07
125 0.07
126 0.07
127 0.05
128 0.06
129 0.05
130 0.05
131 0.05
132 0.05
133 0.06
134 0.05
135 0.06
136 0.06
137 0.08
138 0.08
139 0.1
140 0.1
141 0.11
142 0.12
143 0.13
144 0.13
145 0.12
146 0.13
147 0.12
148 0.12
149 0.11
150 0.13
151 0.16
152 0.18
153 0.26
154 0.28
155 0.29
156 0.3
157 0.3
158 0.3
159 0.29
160 0.32
161 0.31
162 0.29
163 0.29
164 0.36
165 0.38
166 0.44
167 0.5
168 0.54
169 0.55
170 0.64
171 0.72
172 0.75
173 0.82
174 0.84
175 0.8
176 0.8
177 0.76
178 0.67
179 0.58
180 0.47
181 0.37
182 0.27
183 0.21
184 0.12
185 0.07
186 0.06
187 0.05
188 0.05
189 0.04
190 0.04
191 0.04
192 0.04
193 0.06
194 0.06
195 0.09
196 0.09
197 0.1
198 0.11
199 0.11
200 0.12
201 0.1
202 0.11
203 0.11
204 0.11
205 0.11
206 0.1
207 0.1
208 0.1
209 0.15
210 0.15
211 0.19
212 0.2
213 0.21
214 0.23
215 0.26
216 0.28
217 0.26
218 0.31
219 0.29
220 0.3
221 0.31
222 0.28
223 0.25
224 0.22
225 0.19