Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PK20

Protein Details
Accession A0A1E3PK20   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MVNVPKTRRTYCKKCKVHTQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRRTYCKKCKVHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFGGQTKPVFHKKAKTTKKVVLRLECVVCKTKAQLSLKRCKSFELGGDKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.88
4 0.89
5 0.88
6 0.86
7 0.83
8 0.84
9 0.84
10 0.75
11 0.73
12 0.66
13 0.61
14 0.55
15 0.5
16 0.4
17 0.35
18 0.35
19 0.35
20 0.33
21 0.3
22 0.35
23 0.38
24 0.43
25 0.48
26 0.53
27 0.49
28 0.56
29 0.63
30 0.6
31 0.62
32 0.59
33 0.59
34 0.57
35 0.55
36 0.48
37 0.41
38 0.38
39 0.31
40 0.32
41 0.31
42 0.3
43 0.28
44 0.33
45 0.38
46 0.47
47 0.55
48 0.59
49 0.6
50 0.64
51 0.71
52 0.72
53 0.7
54 0.65
55 0.6
56 0.57
57 0.54
58 0.48
59 0.41
60 0.37
61 0.31
62 0.26
63 0.25
64 0.24
65 0.29
66 0.34
67 0.39
68 0.44
69 0.54
70 0.62
71 0.66
72 0.63
73 0.58
74 0.55
75 0.51
76 0.5
77 0.51
78 0.47
79 0.5
80 0.59
81 0.57
82 0.58
83 0.59
84 0.55