Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PIK1

Protein Details
Accession A0A1E3PIK1    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
240-261SEDERPRKKKVKQASSDQEYPFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025602  BCP1_family  
Gene Ontology GO:0005634  C:nucleus  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF13862  BCCIP  
Amino Acid Sequences MAGNGNNIKESSDRLEKRKIEDTRSDDEDSYDEEEGSGYEYADELDDESSDDSGSDIEKNENGEDIVNVDFDFFDFEEIDYHAVNNLLRQLLDADAPLFELSGLADLILKQKVGTTIKTDGKESDPFAMLSVVNMKQHADLPVLTKLRDYFIDKVKTNLDFYKRLRKLFTSQNKSSVGLVLSERLINMPVEVIPPMYKMLQEELDIQAKEDNSFDFEYYLVLSKVFTEEISKLEDSDSDSEDERPRKKKVKQASSDQEYPFHTEDDILHTKATFYHTYTYDREGQEADSKRAFQENGIRPKGHLMLIKKEKFVELIADMEKAYPPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.51
3 0.54
4 0.59
5 0.64
6 0.64
7 0.61
8 0.64
9 0.65
10 0.62
11 0.63
12 0.61
13 0.51
14 0.46
15 0.4
16 0.33
17 0.3
18 0.24
19 0.18
20 0.14
21 0.14
22 0.13
23 0.14
24 0.11
25 0.08
26 0.07
27 0.07
28 0.07
29 0.08
30 0.08
31 0.06
32 0.06
33 0.06
34 0.07
35 0.08
36 0.08
37 0.07
38 0.07
39 0.06
40 0.06
41 0.07
42 0.08
43 0.08
44 0.1
45 0.11
46 0.13
47 0.13
48 0.14
49 0.13
50 0.12
51 0.11
52 0.11
53 0.1
54 0.08
55 0.08
56 0.07
57 0.07
58 0.06
59 0.08
60 0.06
61 0.07
62 0.07
63 0.08
64 0.08
65 0.09
66 0.1
67 0.08
68 0.08
69 0.08
70 0.09
71 0.08
72 0.08
73 0.1
74 0.1
75 0.09
76 0.1
77 0.1
78 0.1
79 0.1
80 0.09
81 0.07
82 0.07
83 0.07
84 0.07
85 0.06
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.03
92 0.04
93 0.04
94 0.07
95 0.07
96 0.07
97 0.07
98 0.08
99 0.13
100 0.15
101 0.16
102 0.17
103 0.24
104 0.29
105 0.3
106 0.31
107 0.28
108 0.29
109 0.3
110 0.27
111 0.23
112 0.18
113 0.17
114 0.17
115 0.16
116 0.12
117 0.1
118 0.12
119 0.11
120 0.1
121 0.11
122 0.11
123 0.1
124 0.12
125 0.13
126 0.1
127 0.1
128 0.12
129 0.17
130 0.17
131 0.17
132 0.16
133 0.15
134 0.16
135 0.17
136 0.18
137 0.17
138 0.23
139 0.29
140 0.28
141 0.3
142 0.31
143 0.3
144 0.29
145 0.29
146 0.26
147 0.26
148 0.28
149 0.38
150 0.38
151 0.39
152 0.38
153 0.37
154 0.38
155 0.42
156 0.5
157 0.48
158 0.47
159 0.5
160 0.5
161 0.48
162 0.43
163 0.34
164 0.24
165 0.17
166 0.15
167 0.11
168 0.1
169 0.09
170 0.08
171 0.07
172 0.08
173 0.06
174 0.06
175 0.05
176 0.05
177 0.05
178 0.05
179 0.06
180 0.05
181 0.06
182 0.07
183 0.07
184 0.07
185 0.07
186 0.09
187 0.1
188 0.1
189 0.12
190 0.13
191 0.17
192 0.16
193 0.16
194 0.16
195 0.16
196 0.15
197 0.14
198 0.11
199 0.1
200 0.11
201 0.11
202 0.09
203 0.09
204 0.09
205 0.09
206 0.1
207 0.07
208 0.07
209 0.07
210 0.07
211 0.08
212 0.08
213 0.07
214 0.08
215 0.09
216 0.1
217 0.14
218 0.14
219 0.13
220 0.13
221 0.14
222 0.14
223 0.15
224 0.16
225 0.13
226 0.14
227 0.17
228 0.23
229 0.29
230 0.33
231 0.37
232 0.43
233 0.51
234 0.57
235 0.63
236 0.68
237 0.72
238 0.73
239 0.79
240 0.81
241 0.8
242 0.8
243 0.73
244 0.65
245 0.56
246 0.53
247 0.43
248 0.33
249 0.26
250 0.19
251 0.19
252 0.23
253 0.25
254 0.21
255 0.2
256 0.19
257 0.19
258 0.2
259 0.24
260 0.18
261 0.17
262 0.21
263 0.23
264 0.28
265 0.3
266 0.33
267 0.36
268 0.34
269 0.34
270 0.3
271 0.3
272 0.33
273 0.35
274 0.35
275 0.31
276 0.31
277 0.31
278 0.35
279 0.33
280 0.29
281 0.35
282 0.4
283 0.47
284 0.51
285 0.51
286 0.46
287 0.51
288 0.5
289 0.44
290 0.4
291 0.35
292 0.41
293 0.51
294 0.55
295 0.52
296 0.5
297 0.47
298 0.43
299 0.39
300 0.32
301 0.24
302 0.24
303 0.22
304 0.22
305 0.2
306 0.2