Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PNZ3

Protein Details
Accession A0A1E3PNZ3   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKKRASNGRNKKGRGHVKPVRCLNCHydrophilic
81-100SKIVRVRSREGRRNRAPPVRBasic
NLS Segment(s)
PositionSequence
3-18KKRASNGRNKKGRGHV
87-106RSREGRRNRAPPVRVRFNKD
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRASNGRNKKGRGHVKPVRCLNCSKCVPKDKAIKRFTIRNMVETAAIRDLSEASVYQQYALPKLYIKVHYCISCAIHSKIVRVRSREGRRNRAPPVRVRFNKDGKKVTPQAAAAAAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.78
4 0.77
5 0.76
6 0.81
7 0.82
8 0.78
9 0.7
10 0.69
11 0.63
12 0.63
13 0.61
14 0.58
15 0.57
16 0.6
17 0.62
18 0.63
19 0.69
20 0.68
21 0.71
22 0.69
23 0.68
24 0.63
25 0.66
26 0.62
27 0.62
28 0.54
29 0.46
30 0.44
31 0.37
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.11
38 0.1
39 0.09
40 0.08
41 0.07
42 0.06
43 0.06
44 0.07
45 0.07
46 0.08
47 0.09
48 0.1
49 0.1
50 0.11
51 0.1
52 0.09
53 0.11
54 0.14
55 0.17
56 0.18
57 0.2
58 0.23
59 0.23
60 0.23
61 0.23
62 0.22
63 0.2
64 0.22
65 0.21
66 0.23
67 0.23
68 0.26
69 0.29
70 0.35
71 0.38
72 0.37
73 0.43
74 0.47
75 0.57
76 0.62
77 0.67
78 0.7
79 0.74
80 0.78
81 0.81
82 0.79
83 0.76
84 0.76
85 0.76
86 0.77
87 0.74
88 0.75
89 0.75
90 0.76
91 0.79
92 0.77
93 0.76
94 0.69
95 0.73
96 0.7
97 0.67
98 0.62
99 0.54
100 0.48