Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H2B1B7

Protein Details
Accession H2B1B7    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
232-251IDIHVLQRPRRHKSKPAEGNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021624  Saw1  
Gene Ontology GO:0070336  F:flap-structured DNA binding  
GO:0000736  P:double-strand break repair via single-strand annealing, removal of nonhomologous ends  
KEGG kaf:KAFR_0K00620  -  
Pfam View protein in Pfam  
PF11561  Saw1  
Amino Acid Sequences MVLNVATVKISDNMVLPLRIFINRKRILENNSSKTIFEAPLLSNNSIVSLKSPNVRLYLSEYDMRNLCEEIRNDLIFIAYEVSSPEILDKIIAKLRIGNSLPYKENVVSKTEGESNKFIASHVETITRVSKFKYKLHFKKNWELDIFINDVRKLSQLRHYLIFSKYRSILPPLIVRPDRRLLLVEHSASSRKPNILIEREEDEEDPFAMQPAEEKPEIKFKYKPVLNVMSCIDIHVLQRPRRHKSKPAEGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.18
6 0.21
7 0.24
8 0.26
9 0.35
10 0.4
11 0.42
12 0.46
13 0.51
14 0.53
15 0.6
16 0.64
17 0.6
18 0.6
19 0.59
20 0.53
21 0.49
22 0.45
23 0.35
24 0.26
25 0.23
26 0.18
27 0.23
28 0.27
29 0.25
30 0.22
31 0.21
32 0.22
33 0.2
34 0.18
35 0.14
36 0.13
37 0.15
38 0.19
39 0.22
40 0.22
41 0.24
42 0.24
43 0.23
44 0.27
45 0.29
46 0.27
47 0.29
48 0.28
49 0.29
50 0.29
51 0.29
52 0.23
53 0.2
54 0.18
55 0.18
56 0.19
57 0.2
58 0.23
59 0.22
60 0.21
61 0.2
62 0.19
63 0.14
64 0.13
65 0.1
66 0.06
67 0.06
68 0.06
69 0.07
70 0.07
71 0.07
72 0.07
73 0.06
74 0.06
75 0.06
76 0.07
77 0.08
78 0.11
79 0.11
80 0.11
81 0.14
82 0.15
83 0.2
84 0.2
85 0.23
86 0.23
87 0.26
88 0.28
89 0.25
90 0.26
91 0.21
92 0.24
93 0.21
94 0.2
95 0.18
96 0.17
97 0.18
98 0.21
99 0.21
100 0.21
101 0.21
102 0.19
103 0.18
104 0.18
105 0.16
106 0.13
107 0.13
108 0.12
109 0.11
110 0.11
111 0.1
112 0.12
113 0.15
114 0.14
115 0.13
116 0.13
117 0.18
118 0.21
119 0.26
120 0.34
121 0.42
122 0.5
123 0.59
124 0.66
125 0.66
126 0.72
127 0.73
128 0.69
129 0.59
130 0.52
131 0.43
132 0.37
133 0.33
134 0.24
135 0.2
136 0.15
137 0.14
138 0.12
139 0.14
140 0.13
141 0.13
142 0.19
143 0.23
144 0.26
145 0.28
146 0.29
147 0.31
148 0.33
149 0.37
150 0.3
151 0.29
152 0.28
153 0.27
154 0.28
155 0.28
156 0.27
157 0.24
158 0.28
159 0.27
160 0.33
161 0.34
162 0.35
163 0.35
164 0.37
165 0.35
166 0.31
167 0.3
168 0.24
169 0.27
170 0.3
171 0.26
172 0.22
173 0.23
174 0.24
175 0.23
176 0.25
177 0.23
178 0.19
179 0.2
180 0.25
181 0.31
182 0.35
183 0.37
184 0.37
185 0.37
186 0.38
187 0.38
188 0.33
189 0.26
190 0.22
191 0.19
192 0.16
193 0.12
194 0.1
195 0.09
196 0.08
197 0.09
198 0.11
199 0.15
200 0.15
201 0.16
202 0.18
203 0.28
204 0.31
205 0.34
206 0.36
207 0.36
208 0.46
209 0.49
210 0.51
211 0.49
212 0.56
213 0.52
214 0.52
215 0.48
216 0.41
217 0.37
218 0.33
219 0.27
220 0.19
221 0.19
222 0.23
223 0.3
224 0.32
225 0.41
226 0.48
227 0.56
228 0.65
229 0.71
230 0.73
231 0.75