Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PQE3

Protein Details
Accession A0A1E3PQE3    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
22-49GSVNSIDSGKKKKRKRTKGNNTNQAVGVHydrophilic
NLS Segment(s)
PositionSequence
30-39GKKKKRKRTK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MAKGQKIVFDDETGSAILKSVGSVNSIDSGKKKKRKRTKGNNTNQAVGVEKPNDEESPSVKKFNFSIQELTENNKESTEDADLALNENEDTLLGPLVPEKLLKIHNTDHQFSESELKFKSSEASQENSDSDTDGEKNDDEATAKATVLTRIPYTQKPALNRSSLSNNGHTRSSHFQDSEDEDGESDSDDDEDSRTNVNKGSFRDKTGSVSLDPSSYKEQQRLKHQLLQVRETLPIYGARQELINRISKNQVTVLIGETGSGKSTQLPQFIYDTMNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.13
3 0.12
4 0.11
5 0.08
6 0.08
7 0.09
8 0.1
9 0.1
10 0.11
11 0.12
12 0.16
13 0.17
14 0.18
15 0.21
16 0.31
17 0.39
18 0.48
19 0.57
20 0.63
21 0.74
22 0.83
23 0.89
24 0.91
25 0.92
26 0.94
27 0.96
28 0.95
29 0.88
30 0.81
31 0.7
32 0.6
33 0.5
34 0.41
35 0.34
36 0.26
37 0.22
38 0.2
39 0.21
40 0.2
41 0.19
42 0.19
43 0.18
44 0.25
45 0.27
46 0.29
47 0.27
48 0.29
49 0.29
50 0.35
51 0.37
52 0.31
53 0.33
54 0.31
55 0.36
56 0.35
57 0.38
58 0.34
59 0.31
60 0.28
61 0.24
62 0.23
63 0.18
64 0.19
65 0.17
66 0.14
67 0.12
68 0.12
69 0.12
70 0.13
71 0.13
72 0.11
73 0.08
74 0.07
75 0.06
76 0.05
77 0.06
78 0.04
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.06
85 0.05
86 0.05
87 0.08
88 0.11
89 0.13
90 0.16
91 0.18
92 0.24
93 0.29
94 0.3
95 0.29
96 0.28
97 0.27
98 0.24
99 0.29
100 0.23
101 0.21
102 0.19
103 0.19
104 0.18
105 0.17
106 0.19
107 0.12
108 0.16
109 0.17
110 0.19
111 0.18
112 0.19
113 0.2
114 0.19
115 0.18
116 0.13
117 0.11
118 0.09
119 0.09
120 0.08
121 0.08
122 0.07
123 0.08
124 0.08
125 0.07
126 0.07
127 0.07
128 0.08
129 0.08
130 0.08
131 0.08
132 0.08
133 0.09
134 0.09
135 0.1
136 0.09
137 0.1
138 0.14
139 0.15
140 0.2
141 0.24
142 0.26
143 0.29
144 0.33
145 0.35
146 0.34
147 0.34
148 0.31
149 0.31
150 0.33
151 0.32
152 0.33
153 0.33
154 0.32
155 0.33
156 0.3
157 0.3
158 0.31
159 0.32
160 0.29
161 0.26
162 0.25
163 0.27
164 0.31
165 0.29
166 0.24
167 0.2
168 0.16
169 0.16
170 0.15
171 0.12
172 0.08
173 0.05
174 0.05
175 0.05
176 0.05
177 0.05
178 0.06
179 0.07
180 0.09
181 0.1
182 0.11
183 0.13
184 0.17
185 0.2
186 0.23
187 0.32
188 0.32
189 0.34
190 0.37
191 0.35
192 0.36
193 0.35
194 0.34
195 0.26
196 0.26
197 0.23
198 0.22
199 0.21
200 0.2
201 0.23
202 0.26
203 0.28
204 0.33
205 0.39
206 0.43
207 0.53
208 0.6
209 0.59
210 0.61
211 0.62
212 0.61
213 0.6
214 0.57
215 0.5
216 0.42
217 0.39
218 0.32
219 0.28
220 0.23
221 0.21
222 0.19
223 0.19
224 0.18
225 0.16
226 0.18
227 0.19
228 0.23
229 0.24
230 0.29
231 0.27
232 0.29
233 0.36
234 0.35
235 0.36
236 0.33
237 0.33
238 0.27
239 0.27
240 0.26
241 0.21
242 0.19
243 0.17
244 0.17
245 0.13
246 0.13
247 0.12
248 0.1
249 0.11
250 0.19
251 0.23
252 0.26
253 0.27
254 0.28
255 0.31
256 0.32