Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H2AVZ4

Protein Details
Accession H2AVZ4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
183-211QDLKNKSIWKRWWLKCQKSCYKLCKNLLAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, plas 8, E.R. 6, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013862  Kei1  
Gene Ontology GO:0016020  C:membrane  
GO:0070917  F:inositol phosphoceramide synthase regulator activity  
GO:0006673  P:inositol phosphoceramide metabolic process  
KEGG kaf:KAFR_0E03930  -  
Pfam View protein in Pfam  
PF08552  Kei1  
Amino Acid Sequences MRTTSFSLPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWSTVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAAVGSTITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMFDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.18
4 0.17
5 0.13
6 0.12
7 0.11
8 0.06
9 0.06
10 0.05
11 0.04
12 0.03
13 0.03
14 0.03
15 0.04
16 0.05
17 0.05
18 0.05
19 0.05
20 0.05
21 0.06
22 0.06
23 0.08
24 0.07
25 0.07
26 0.08
27 0.07
28 0.07
29 0.07
30 0.07
31 0.05
32 0.06
33 0.05
34 0.05
35 0.06
36 0.06
37 0.07
38 0.07
39 0.08
40 0.07
41 0.08
42 0.09
43 0.09
44 0.09
45 0.07
46 0.1
47 0.09
48 0.1
49 0.09
50 0.1
51 0.09
52 0.09
53 0.1
54 0.07
55 0.07
56 0.06
57 0.06
58 0.06
59 0.07
60 0.09
61 0.08
62 0.11
63 0.1
64 0.11
65 0.13
66 0.12
67 0.14
68 0.12
69 0.15
70 0.13
71 0.13
72 0.13
73 0.11
74 0.11
75 0.08
76 0.09
77 0.07
78 0.07
79 0.07
80 0.08
81 0.08
82 0.08
83 0.08
84 0.07
85 0.07
86 0.09
87 0.1
88 0.1
89 0.1
90 0.1
91 0.1
92 0.1
93 0.11
94 0.09
95 0.08
96 0.07
97 0.07
98 0.07
99 0.06
100 0.06
101 0.06
102 0.05
103 0.05
104 0.04
105 0.04
106 0.05
107 0.06
108 0.07
109 0.07
110 0.08
111 0.08
112 0.1
113 0.12
114 0.12
115 0.13
116 0.15
117 0.15
118 0.15
119 0.16
120 0.15
121 0.13
122 0.12
123 0.1
124 0.07
125 0.07
126 0.07
127 0.07
128 0.07
129 0.07
130 0.07
131 0.06
132 0.06
133 0.06
134 0.06
135 0.05
136 0.05
137 0.06
138 0.07
139 0.07
140 0.08
141 0.09
142 0.11
143 0.12
144 0.12
145 0.13
146 0.11
147 0.15
148 0.14
149 0.15
150 0.13
151 0.13
152 0.13
153 0.13
154 0.15
155 0.2
156 0.22
157 0.21
158 0.2
159 0.24
160 0.29
161 0.36
162 0.37
163 0.31
164 0.32
165 0.32
166 0.36
167 0.35
168 0.31
169 0.23
170 0.22
171 0.21
172 0.19
173 0.2
174 0.23
175 0.25
176 0.34
177 0.4
178 0.48
179 0.57
180 0.64
181 0.74
182 0.78
183 0.84
184 0.83
185 0.86
186 0.87
187 0.85
188 0.86
189 0.86
190 0.86
191 0.84