Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PQL9

Protein Details
Accession A0A1E3PQL9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
54-82DQDFDFEKEERKKKKRKLMKIKRQQLKSSBasic
NLS Segment(s)
PositionSequence
63-79ERKKKKRKLMKIKRQQL
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046757  YL1_N  
Pfam View protein in Pfam  
PF05764  YL1  
Amino Acid Sequences MSGSDSDTFDSFDLSQSLVATRARRANAGNRLRVLLNAEEPLEEDEIFLEVENDQDFDFEKEERKKKKRKLMKIKRQQLKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.1
5 0.11
6 0.13
7 0.13
8 0.17
9 0.21
10 0.22
11 0.24
12 0.26
13 0.32
14 0.39
15 0.44
16 0.44
17 0.4
18 0.41
19 0.39
20 0.36
21 0.3
22 0.21
23 0.16
24 0.13
25 0.12
26 0.1
27 0.1
28 0.11
29 0.09
30 0.08
31 0.06
32 0.05
33 0.06
34 0.06
35 0.05
36 0.05
37 0.04
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.06
44 0.07
45 0.09
46 0.09
47 0.16
48 0.25
49 0.34
50 0.44
51 0.53
52 0.63
53 0.71
54 0.81
55 0.85
56 0.88
57 0.91
58 0.92
59 0.93
60 0.94
61 0.95
62 0.94