Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PQT2

Protein Details
Accession A0A1E3PQT2   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-33ASISHPKIVKKNGNKKFKRHHSDRYHRVGESBasic
NLS Segment(s)
PositionSequence
9-37KIVKKNGNKKFKRHHSDRYHRVGESWRKP
Subcellular Location(s) mito 18, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASISHPKIVKKNGNKKFKRHHSDRYHRVGESWRKPKGIDSCVRRRFRGTIAMPKIGYGSNQRTKYMMPSGHKAFRVFNVADVELLLLHQKSYAAEIASTVSSKNRLAIIEKAKSLGVKVTNAGGRLSAQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.79
3 0.82
4 0.85
5 0.87
6 0.88
7 0.87
8 0.85
9 0.86
10 0.86
11 0.9
12 0.89
13 0.88
14 0.81
15 0.7
16 0.64
17 0.63
18 0.62
19 0.61
20 0.6
21 0.55
22 0.51
23 0.51
24 0.55
25 0.54
26 0.52
27 0.5
28 0.5
29 0.57
30 0.65
31 0.68
32 0.63
33 0.58
34 0.53
35 0.48
36 0.49
37 0.43
38 0.44
39 0.44
40 0.46
41 0.42
42 0.39
43 0.37
44 0.28
45 0.24
46 0.19
47 0.22
48 0.26
49 0.28
50 0.28
51 0.28
52 0.28
53 0.3
54 0.3
55 0.27
56 0.22
57 0.26
58 0.3
59 0.33
60 0.35
61 0.33
62 0.29
63 0.26
64 0.28
65 0.23
66 0.21
67 0.2
68 0.18
69 0.17
70 0.16
71 0.14
72 0.09
73 0.09
74 0.07
75 0.05
76 0.04
77 0.05
78 0.05
79 0.05
80 0.07
81 0.09
82 0.08
83 0.08
84 0.08
85 0.1
86 0.1
87 0.1
88 0.09
89 0.09
90 0.11
91 0.12
92 0.13
93 0.14
94 0.15
95 0.18
96 0.25
97 0.31
98 0.34
99 0.34
100 0.33
101 0.32
102 0.31
103 0.29
104 0.27
105 0.22
106 0.19
107 0.2
108 0.24
109 0.25
110 0.26
111 0.25
112 0.21