Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3PPW6

Protein Details
Accession A0A1E3PPW6    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
36-57EDSLSRTCRRKLKPKGISNGIQHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, cyto_nucl 11.333, cyto_mito 8.666, nucl 7, cysk 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045886  ThiF/MoeB/HesA  
IPR035985  Ubiquitin-activating_enz  
Gene Ontology GO:0008641  F:ubiquitin-like modifier activating enzyme activity  
Amino Acid Sequences MEFCYRNEIKLISSMGAACKGDPSSVRICDISQSLEDSLSRTCRRKLKPKGISNGIQVVFSTEKPPNADSNSGSGSGKASLMPLAEEEFLKGNVDELGVLNRFRVRILPVLGTMPGLFGLNMANHVVLEIANPKLVPEYVLGRFGLKFYDTPLQGLLGQLQRLGYGEVRVPWNLEDIMFLVEEVFRGKSVISGSTNRINLSMWAKGAGYDRDNIVVMTKEEQRKHEDLVLKKGMSVEEVYRKSVCDLAESRLHDVKWYEHYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.22
4 0.21
5 0.16
6 0.17
7 0.17
8 0.18
9 0.17
10 0.21
11 0.23
12 0.25
13 0.27
14 0.25
15 0.25
16 0.26
17 0.26
18 0.24
19 0.19
20 0.19
21 0.17
22 0.18
23 0.17
24 0.16
25 0.17
26 0.22
27 0.27
28 0.29
29 0.35
30 0.43
31 0.53
32 0.62
33 0.7
34 0.74
35 0.78
36 0.83
37 0.86
38 0.84
39 0.8
40 0.73
41 0.7
42 0.59
43 0.48
44 0.39
45 0.33
46 0.27
47 0.22
48 0.22
49 0.16
50 0.18
51 0.2
52 0.22
53 0.23
54 0.24
55 0.26
56 0.23
57 0.25
58 0.25
59 0.24
60 0.22
61 0.18
62 0.16
63 0.14
64 0.13
65 0.1
66 0.08
67 0.08
68 0.08
69 0.07
70 0.07
71 0.07
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.09
78 0.08
79 0.07
80 0.07
81 0.07
82 0.06
83 0.05
84 0.08
85 0.08
86 0.08
87 0.09
88 0.09
89 0.1
90 0.1
91 0.11
92 0.1
93 0.13
94 0.15
95 0.15
96 0.14
97 0.15
98 0.15
99 0.14
100 0.11
101 0.08
102 0.06
103 0.05
104 0.04
105 0.04
106 0.04
107 0.04
108 0.05
109 0.05
110 0.05
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.06
122 0.06
123 0.06
124 0.06
125 0.09
126 0.1
127 0.11
128 0.11
129 0.12
130 0.12
131 0.11
132 0.11
133 0.08
134 0.07
135 0.09
136 0.14
137 0.13
138 0.14
139 0.14
140 0.14
141 0.13
142 0.13
143 0.14
144 0.1
145 0.1
146 0.1
147 0.1
148 0.09
149 0.09
150 0.1
151 0.07
152 0.07
153 0.08
154 0.1
155 0.12
156 0.12
157 0.12
158 0.11
159 0.13
160 0.12
161 0.1
162 0.09
163 0.08
164 0.09
165 0.08
166 0.07
167 0.06
168 0.05
169 0.06
170 0.06
171 0.06
172 0.05
173 0.06
174 0.06
175 0.07
176 0.09
177 0.12
178 0.14
179 0.16
180 0.2
181 0.26
182 0.27
183 0.26
184 0.25
185 0.22
186 0.23
187 0.23
188 0.21
189 0.15
190 0.15
191 0.15
192 0.16
193 0.19
194 0.19
195 0.18
196 0.17
197 0.18
198 0.18
199 0.19
200 0.17
201 0.15
202 0.13
203 0.13
204 0.15
205 0.22
206 0.27
207 0.3
208 0.34
209 0.39
210 0.4
211 0.42
212 0.45
213 0.46
214 0.44
215 0.49
216 0.52
217 0.45
218 0.44
219 0.42
220 0.36
221 0.3
222 0.28
223 0.25
224 0.27
225 0.29
226 0.32
227 0.3
228 0.31
229 0.31
230 0.31
231 0.26
232 0.23
233 0.24
234 0.26
235 0.32
236 0.34
237 0.38
238 0.38
239 0.38
240 0.35
241 0.35
242 0.34