Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3PP33

Protein Details
Accession A0A1E3PP33    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
28-48QEKAKTPKGRAKKRLLYTRRFBasic
NLS Segment(s)
PositionSequence
27-41KQEKAKTPKGRAKKR
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MDVIPGKVHGSLARAGKVKSQCPKVDKQEKAKTPKGRAKKRLLYTRRFVNVTLTNGKRKMNPGPSSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.3
4 0.34
5 0.38
6 0.41
7 0.46
8 0.47
9 0.49
10 0.57
11 0.61
12 0.66
13 0.66
14 0.68
15 0.7
16 0.72
17 0.74
18 0.74
19 0.71
20 0.7
21 0.71
22 0.71
23 0.72
24 0.73
25 0.75
26 0.76
27 0.78
28 0.8
29 0.8
30 0.78
31 0.74
32 0.74
33 0.69
34 0.61
35 0.53
36 0.5
37 0.47
38 0.44
39 0.47
40 0.43
41 0.45
42 0.46
43 0.49
44 0.46
45 0.46
46 0.5
47 0.51