Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PQW0

Protein Details
Accession A0A1E3PQW0    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-42LLWKNPWRMSKFQKYRQRKRMQNVDNTIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, mito_nucl 12.833, cyto_nucl 3.333, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRASMPTFGGLLWKNPWRMSKFQKYRQRKRMQNVDNTIDLLSQGLEKLGLKKVKVIENFKASTPKESEMSAKDKYTVFHKGSKGYRKGIHKVPKWTRLTERIFPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.24
4 0.25
5 0.27
6 0.3
7 0.37
8 0.36
9 0.43
10 0.5
11 0.56
12 0.61
13 0.69
14 0.76
15 0.81
16 0.87
17 0.9
18 0.91
19 0.88
20 0.88
21 0.89
22 0.86
23 0.84
24 0.8
25 0.72
26 0.63
27 0.55
28 0.45
29 0.34
30 0.26
31 0.16
32 0.1
33 0.06
34 0.05
35 0.04
36 0.04
37 0.04
38 0.06
39 0.11
40 0.13
41 0.13
42 0.16
43 0.19
44 0.24
45 0.29
46 0.32
47 0.32
48 0.35
49 0.37
50 0.35
51 0.38
52 0.33
53 0.32
54 0.3
55 0.27
56 0.23
57 0.23
58 0.25
59 0.22
60 0.26
61 0.25
62 0.23
63 0.23
64 0.23
65 0.23
66 0.24
67 0.28
68 0.26
69 0.3
70 0.33
71 0.38
72 0.45
73 0.54
74 0.55
75 0.54
76 0.59
77 0.6
78 0.64
79 0.66
80 0.69
81 0.66
82 0.72
83 0.74
84 0.77
85 0.74
86 0.74
87 0.72
88 0.72
89 0.72
90 0.7
91 0.69