Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PPP2

Protein Details
Accession A0A1E3PPP2    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
27-52LSCVYRSTKNNKQKKPRYRTYIQYETHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MQFRAGICLRGYTLGQAREVEMTGIVLSCVYRSTKNNKQKKPRYRTYIQYETSRVFRFLVSPSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.2
4 0.2
5 0.19
6 0.19
7 0.15
8 0.09
9 0.08
10 0.06
11 0.06
12 0.05
13 0.04
14 0.04
15 0.04
16 0.05
17 0.06
18 0.08
19 0.11
20 0.19
21 0.29
22 0.4
23 0.49
24 0.58
25 0.68
26 0.76
27 0.84
28 0.86
29 0.86
30 0.85
31 0.82
32 0.82
33 0.81
34 0.79
35 0.73
36 0.69
37 0.62
38 0.57
39 0.56
40 0.48
41 0.4
42 0.32
43 0.28
44 0.25