Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PS29

Protein Details
Accession A0A1E3PS29   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
266-290WGEHVVNKKKKQLWRRKDDELSYPYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 12.833, nucl 11, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR009446  Mgm101  
Gene Ontology GO:0000262  C:mitochondrial chromosome  
GO:0003697  F:single-stranded DNA binding  
GO:0006281  P:DNA repair  
GO:0000002  P:mitochondrial genome maintenance  
Pfam View protein in Pfam  
PF06420  Mgm101p  
Amino Acid Sequences MSSNILPIAFKRAVKPTSLLLNHRMITTTHRKFSADKPSKSRTSNSSTDFKKPEVGNSDSSNRKFEADAILVNKDPWATSLLASEFRDQNEVLSSSSGEIVNEKKNNGDPLVPSSVILSDVDWSTSYSGMGSQPFSREIADILSSSIDSNDIEITPDGLLFLPEIKYRRVLNKAFGPGGWALAPRDRMAINVRTVTREFGLICHGRLVSVARGEQDFFDESNIPTAAEGCKSNAMMRCCKDLGIASELWDPRFIRTFKKKYCIQEWGEHVVNKKKKQLWRRKDDELSYPYKATR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.35
4 0.41
5 0.44
6 0.44
7 0.41
8 0.46
9 0.44
10 0.42
11 0.39
12 0.3
13 0.33
14 0.39
15 0.41
16 0.4
17 0.41
18 0.42
19 0.45
20 0.52
21 0.55
22 0.55
23 0.55
24 0.58
25 0.65
26 0.7
27 0.7
28 0.67
29 0.62
30 0.6
31 0.59
32 0.56
33 0.57
34 0.54
35 0.58
36 0.56
37 0.5
38 0.5
39 0.44
40 0.45
41 0.43
42 0.42
43 0.38
44 0.4
45 0.46
46 0.45
47 0.47
48 0.43
49 0.37
50 0.35
51 0.31
52 0.28
53 0.26
54 0.21
55 0.22
56 0.21
57 0.23
58 0.22
59 0.21
60 0.2
61 0.14
62 0.13
63 0.1
64 0.1
65 0.09
66 0.09
67 0.12
68 0.13
69 0.16
70 0.18
71 0.2
72 0.19
73 0.19
74 0.21
75 0.18
76 0.17
77 0.16
78 0.16
79 0.13
80 0.12
81 0.12
82 0.1
83 0.11
84 0.11
85 0.08
86 0.09
87 0.11
88 0.17
89 0.18
90 0.18
91 0.19
92 0.21
93 0.23
94 0.22
95 0.21
96 0.16
97 0.19
98 0.22
99 0.2
100 0.18
101 0.16
102 0.15
103 0.14
104 0.13
105 0.08
106 0.06
107 0.06
108 0.07
109 0.06
110 0.07
111 0.07
112 0.07
113 0.06
114 0.05
115 0.06
116 0.07
117 0.07
118 0.08
119 0.08
120 0.09
121 0.1
122 0.11
123 0.1
124 0.09
125 0.09
126 0.08
127 0.08
128 0.07
129 0.07
130 0.06
131 0.06
132 0.06
133 0.05
134 0.05
135 0.04
136 0.04
137 0.05
138 0.04
139 0.05
140 0.05
141 0.06
142 0.05
143 0.05
144 0.05
145 0.04
146 0.05
147 0.04
148 0.05
149 0.05
150 0.07
151 0.09
152 0.1
153 0.13
154 0.15
155 0.2
156 0.26
157 0.27
158 0.3
159 0.34
160 0.37
161 0.34
162 0.32
163 0.29
164 0.23
165 0.21
166 0.17
167 0.12
168 0.09
169 0.11
170 0.13
171 0.11
172 0.12
173 0.11
174 0.13
175 0.16
176 0.19
177 0.19
178 0.22
179 0.22
180 0.24
181 0.24
182 0.24
183 0.2
184 0.18
185 0.16
186 0.12
187 0.18
188 0.16
189 0.16
190 0.16
191 0.16
192 0.14
193 0.15
194 0.16
195 0.12
196 0.13
197 0.14
198 0.13
199 0.14
200 0.15
201 0.14
202 0.14
203 0.14
204 0.12
205 0.13
206 0.13
207 0.12
208 0.15
209 0.15
210 0.12
211 0.11
212 0.12
213 0.11
214 0.11
215 0.12
216 0.11
217 0.13
218 0.13
219 0.18
220 0.22
221 0.26
222 0.31
223 0.33
224 0.37
225 0.35
226 0.34
227 0.32
228 0.29
229 0.28
230 0.25
231 0.23
232 0.2
233 0.25
234 0.26
235 0.25
236 0.26
237 0.23
238 0.22
239 0.29
240 0.28
241 0.32
242 0.42
243 0.52
244 0.56
245 0.64
246 0.68
247 0.69
248 0.76
249 0.76
250 0.7
251 0.68
252 0.66
253 0.65
254 0.63
255 0.56
256 0.54
257 0.55
258 0.58
259 0.55
260 0.59
261 0.59
262 0.64
263 0.73
264 0.78
265 0.79
266 0.81
267 0.84
268 0.85
269 0.87
270 0.83
271 0.81
272 0.76
273 0.72
274 0.65