Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3PDD5

Protein Details
Accession A0A1E3PDD5    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
141-168ASSANPAKKKKSKYKANKPKPVGKPPTIHydrophilic
NLS Segment(s)
PositionSequence
146-165PAKKKKSKYKANKPKPVGKP
Subcellular Location(s) nucl 20.5, cyto_nucl 14.833, cyto 6
Family & Domain DBs
Amino Acid Sequences MSDPGSLIQGDYPLENTTDTRVEDIRQAIRLVRDPSSFRKTTFGPDDPRRFNNSRSSIPDHFLDLEIEGDLVNEIAPKKLLGKDTDMTINDKMMQGDYGRIHGQNHGHNFYSMPSMSVALSNDNALSFNSNCDDSTKGTSASSANPAKKKKSKYKANKPKPVGKPPTINSKSNKVSNTTAHNDNNNSGSSAVTDDTSRISDAFNTEPPSEKNLIMSEKYDLLCKLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.14
5 0.16
6 0.16
7 0.18
8 0.18
9 0.19
10 0.22
11 0.26
12 0.26
13 0.25
14 0.26
15 0.26
16 0.28
17 0.33
18 0.32
19 0.31
20 0.31
21 0.34
22 0.4
23 0.45
24 0.43
25 0.38
26 0.39
27 0.37
28 0.41
29 0.44
30 0.43
31 0.44
32 0.53
33 0.6
34 0.62
35 0.65
36 0.64
37 0.6
38 0.57
39 0.58
40 0.54
41 0.51
42 0.52
43 0.55
44 0.5
45 0.5
46 0.46
47 0.38
48 0.33
49 0.28
50 0.22
51 0.15
52 0.13
53 0.1
54 0.09
55 0.07
56 0.05
57 0.05
58 0.04
59 0.04
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.09
66 0.12
67 0.15
68 0.15
69 0.19
70 0.2
71 0.22
72 0.25
73 0.24
74 0.23
75 0.21
76 0.2
77 0.16
78 0.16
79 0.14
80 0.11
81 0.1
82 0.08
83 0.1
84 0.1
85 0.11
86 0.12
87 0.12
88 0.12
89 0.15
90 0.18
91 0.19
92 0.23
93 0.23
94 0.22
95 0.21
96 0.21
97 0.19
98 0.18
99 0.13
100 0.1
101 0.08
102 0.08
103 0.08
104 0.09
105 0.08
106 0.07
107 0.07
108 0.07
109 0.07
110 0.06
111 0.06
112 0.05
113 0.07
114 0.06
115 0.07
116 0.08
117 0.09
118 0.09
119 0.1
120 0.11
121 0.11
122 0.15
123 0.15
124 0.15
125 0.14
126 0.15
127 0.15
128 0.15
129 0.2
130 0.22
131 0.26
132 0.32
133 0.36
134 0.44
135 0.5
136 0.58
137 0.61
138 0.66
139 0.73
140 0.77
141 0.85
142 0.88
143 0.92
144 0.93
145 0.9
146 0.89
147 0.87
148 0.87
149 0.83
150 0.78
151 0.76
152 0.69
153 0.73
154 0.67
155 0.64
156 0.57
157 0.58
158 0.57
159 0.54
160 0.53
161 0.46
162 0.46
163 0.45
164 0.48
165 0.44
166 0.45
167 0.43
168 0.46
169 0.43
170 0.41
171 0.39
172 0.33
173 0.28
174 0.22
175 0.18
176 0.14
177 0.13
178 0.12
179 0.1
180 0.1
181 0.09
182 0.11
183 0.12
184 0.12
185 0.1
186 0.11
187 0.11
188 0.14
189 0.17
190 0.19
191 0.23
192 0.23
193 0.27
194 0.28
195 0.32
196 0.32
197 0.29
198 0.28
199 0.28
200 0.32
201 0.3
202 0.3
203 0.27
204 0.29
205 0.29
206 0.29