Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H2AXA0

Protein Details
Accession H2AXA0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MPQKALKVTKKTKDPRRITKKQKNLRKAAPLQHydrophilic
NLS Segment(s)
PositionSequence
7-45KVTKKTKDPRRITKKQKNLRKAAPLQIKSKKRALNHLKK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG kaf:KAFR_0F04050  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MPQKALKVTKKTKDPRRITKKQKNLRKAAPLQIKSKKRALNHLKKLSKTASLTESTEKLIASRVGHLELLKGTRREIEKNNKNKNSLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.89
4 0.91
5 0.92
6 0.92
7 0.92
8 0.92
9 0.92
10 0.91
11 0.89
12 0.86
13 0.84
14 0.79
15 0.78
16 0.77
17 0.71
18 0.7
19 0.7
20 0.68
21 0.63
22 0.64
23 0.59
24 0.51
25 0.58
26 0.6
27 0.62
28 0.66
29 0.71
30 0.69
31 0.65
32 0.67
33 0.58
34 0.51
35 0.42
36 0.34
37 0.27
38 0.24
39 0.25
40 0.24
41 0.23
42 0.19
43 0.19
44 0.16
45 0.13
46 0.13
47 0.13
48 0.12
49 0.14
50 0.14
51 0.14
52 0.16
53 0.15
54 0.15
55 0.14
56 0.17
57 0.2
58 0.2
59 0.19
60 0.24
61 0.28
62 0.33
63 0.4
64 0.48
65 0.53
66 0.63
67 0.73
68 0.75