Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PHL9

Protein Details
Accession A0A1E3PHL9   
Localization Confidence Low
Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
731-751NPDCGLKTRKWDETKKQLTNMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, cyto_mito 10.5, cyto 8.5, nucl 2, extr 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013215  Cbl-indep_Met_Synth_N  
IPR006276  Cobalamin-indep_Met_synthase  
IPR002629  Met_Synth_C/arc  
IPR038071  UROD/MetE-like_sf  
Gene Ontology GO:0003871  F:5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity  
GO:0008270  F:zinc ion binding  
GO:0009086  P:methionine biosynthetic process  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF08267  Meth_synt_1  
PF01717  Meth_synt_2  
CDD cd03311  CIMS_C_terminal_like  
cd03312  CIMS_N_terminal_like  
Amino Acid Sequences MVLSSVLGFPRIGAQRELKKTTEAYWAGKVDIAELERVGKDLRAQNWAKQQAAGVDIIPSNDFSYYDHILDLSLSLNIVAERYSKYNLSTIDTTFAMGRGLQREGVDVPANEMVKWFDSNYHYVRPTFSHSTAFKLNNTKAVDEYLEAKAQGIETRPVLIGPVSLLFLGKADKDSQDLEPISLLEKLLPIYADYLAKIAAAGAASVQIDEPILVLDLPENVQAAFKTAYEFLANYQATLPKITIASYFGDARPNLAAIKGLPVAGFHYDFVRVPEQLEEVAAALTPEQTLSVGIVDGRNVWKADFAKALKIVEAAKAKIGADRVVVATSSSLLHTPVTLENEIKLNPEIKDWLSFATQKLDEVVIIAKAATHGVESVAAEFAANAASIAARASSSITNDPAVRQRVESITADQIKRKSAFATRLEEQKKNLNLPSFPTTTIGSFPQTKEIRINRNKFTKGEITAAEYEKFIEQEIAEVVKFQEEVGLDVLVHGEPERNDMVQYFGERLKGFVFTQNGWVQSYGSRYVRPPIIVGDVSRPAPMTVKESKFAQSLTSKPMKGMLTGPVTCLRWSFPRNDISPKQQAQQLALALRDEVNDLEAAGIYVIQVDEPAIREGLPLRAGAERDDYVKYAVESFRLSTSGVEDKTQIHSHFCYSDLDPAHIKALDADVVSIEFSKKDDNKYIEEFSNYPNHIGLGVFDIHSPRVPSQEELEAKIQSIVGVYPKENLWVNPDCGLKTRKWDETKKQLTNMVNAAKIYREKYSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.43
3 0.51
4 0.56
5 0.5
6 0.49
7 0.49
8 0.48
9 0.49
10 0.44
11 0.4
12 0.42
13 0.41
14 0.38
15 0.38
16 0.34
17 0.26
18 0.25
19 0.22
20 0.17
21 0.16
22 0.18
23 0.16
24 0.17
25 0.16
26 0.14
27 0.2
28 0.25
29 0.27
30 0.34
31 0.37
32 0.42
33 0.52
34 0.57
35 0.51
36 0.46
37 0.44
38 0.37
39 0.37
40 0.31
41 0.21
42 0.17
43 0.16
44 0.16
45 0.15
46 0.13
47 0.12
48 0.12
49 0.12
50 0.11
51 0.16
52 0.18
53 0.18
54 0.17
55 0.16
56 0.16
57 0.15
58 0.14
59 0.1
60 0.07
61 0.06
62 0.06
63 0.07
64 0.06
65 0.07
66 0.07
67 0.08
68 0.1
69 0.13
70 0.16
71 0.17
72 0.19
73 0.23
74 0.24
75 0.28
76 0.28
77 0.26
78 0.26
79 0.25
80 0.24
81 0.21
82 0.19
83 0.14
84 0.12
85 0.15
86 0.14
87 0.16
88 0.17
89 0.16
90 0.18
91 0.18
92 0.2
93 0.2
94 0.17
95 0.19
96 0.21
97 0.21
98 0.19
99 0.19
100 0.17
101 0.16
102 0.17
103 0.15
104 0.15
105 0.19
106 0.24
107 0.27
108 0.32
109 0.33
110 0.33
111 0.34
112 0.32
113 0.36
114 0.37
115 0.35
116 0.36
117 0.34
118 0.38
119 0.43
120 0.43
121 0.4
122 0.42
123 0.42
124 0.42
125 0.43
126 0.39
127 0.33
128 0.33
129 0.29
130 0.22
131 0.24
132 0.19
133 0.18
134 0.17
135 0.16
136 0.15
137 0.14
138 0.15
139 0.14
140 0.14
141 0.14
142 0.15
143 0.15
144 0.14
145 0.14
146 0.12
147 0.1
148 0.08
149 0.08
150 0.07
151 0.07
152 0.07
153 0.06
154 0.07
155 0.08
156 0.07
157 0.09
158 0.1
159 0.11
160 0.13
161 0.15
162 0.16
163 0.2
164 0.2
165 0.19
166 0.17
167 0.17
168 0.16
169 0.14
170 0.13
171 0.08
172 0.08
173 0.08
174 0.08
175 0.08
176 0.07
177 0.08
178 0.1
179 0.1
180 0.09
181 0.09
182 0.09
183 0.08
184 0.08
185 0.06
186 0.05
187 0.04
188 0.04
189 0.04
190 0.05
191 0.05
192 0.05
193 0.05
194 0.04
195 0.04
196 0.04
197 0.04
198 0.04
199 0.04
200 0.04
201 0.04
202 0.04
203 0.05
204 0.05
205 0.06
206 0.06
207 0.06
208 0.06
209 0.06
210 0.09
211 0.09
212 0.08
213 0.1
214 0.1
215 0.11
216 0.11
217 0.11
218 0.1
219 0.17
220 0.17
221 0.15
222 0.16
223 0.18
224 0.17
225 0.18
226 0.17
227 0.1
228 0.11
229 0.11
230 0.1
231 0.1
232 0.11
233 0.12
234 0.14
235 0.13
236 0.17
237 0.16
238 0.17
239 0.15
240 0.14
241 0.13
242 0.11
243 0.11
244 0.07
245 0.1
246 0.09
247 0.09
248 0.08
249 0.08
250 0.09
251 0.1
252 0.11
253 0.08
254 0.09
255 0.1
256 0.1
257 0.13
258 0.13
259 0.11
260 0.12
261 0.12
262 0.12
263 0.11
264 0.11
265 0.08
266 0.06
267 0.06
268 0.05
269 0.04
270 0.04
271 0.04
272 0.04
273 0.03
274 0.03
275 0.03
276 0.04
277 0.04
278 0.04
279 0.04
280 0.04
281 0.05
282 0.05
283 0.06
284 0.07
285 0.08
286 0.08
287 0.08
288 0.12
289 0.13
290 0.14
291 0.18
292 0.18
293 0.19
294 0.21
295 0.21
296 0.18
297 0.18
298 0.17
299 0.16
300 0.18
301 0.15
302 0.14
303 0.15
304 0.14
305 0.15
306 0.15
307 0.11
308 0.09
309 0.1
310 0.09
311 0.09
312 0.08
313 0.07
314 0.06
315 0.06
316 0.06
317 0.05
318 0.05
319 0.06
320 0.06
321 0.06
322 0.07
323 0.08
324 0.1
325 0.11
326 0.11
327 0.11
328 0.12
329 0.12
330 0.12
331 0.12
332 0.11
333 0.11
334 0.11
335 0.13
336 0.12
337 0.13
338 0.12
339 0.13
340 0.12
341 0.13
342 0.13
343 0.15
344 0.15
345 0.13
346 0.14
347 0.12
348 0.1
349 0.09
350 0.09
351 0.05
352 0.05
353 0.05
354 0.04
355 0.04
356 0.04
357 0.04
358 0.03
359 0.03
360 0.03
361 0.04
362 0.04
363 0.04
364 0.04
365 0.04
366 0.04
367 0.04
368 0.04
369 0.03
370 0.03
371 0.02
372 0.02
373 0.02
374 0.03
375 0.03
376 0.03
377 0.02
378 0.03
379 0.04
380 0.05
381 0.07
382 0.08
383 0.09
384 0.1
385 0.1
386 0.11
387 0.15
388 0.17
389 0.16
390 0.15
391 0.16
392 0.16
393 0.19
394 0.18
395 0.15
396 0.18
397 0.23
398 0.23
399 0.24
400 0.25
401 0.26
402 0.26
403 0.24
404 0.21
405 0.21
406 0.28
407 0.29
408 0.34
409 0.32
410 0.4
411 0.44
412 0.44
413 0.41
414 0.41
415 0.39
416 0.36
417 0.37
418 0.3
419 0.27
420 0.29
421 0.32
422 0.26
423 0.24
424 0.23
425 0.2
426 0.19
427 0.19
428 0.16
429 0.14
430 0.15
431 0.15
432 0.22
433 0.22
434 0.22
435 0.28
436 0.33
437 0.41
438 0.48
439 0.53
440 0.52
441 0.59
442 0.61
443 0.55
444 0.54
445 0.48
446 0.42
447 0.39
448 0.32
449 0.28
450 0.28
451 0.29
452 0.24
453 0.19
454 0.17
455 0.15
456 0.14
457 0.1
458 0.08
459 0.06
460 0.07
461 0.07
462 0.07
463 0.07
464 0.07
465 0.07
466 0.07
467 0.07
468 0.06
469 0.07
470 0.06
471 0.08
472 0.08
473 0.08
474 0.07
475 0.07
476 0.08
477 0.06
478 0.06
479 0.05
480 0.06
481 0.06
482 0.09
483 0.1
484 0.09
485 0.1
486 0.1
487 0.12
488 0.11
489 0.12
490 0.12
491 0.12
492 0.15
493 0.14
494 0.15
495 0.14
496 0.15
497 0.15
498 0.17
499 0.18
500 0.16
501 0.22
502 0.23
503 0.23
504 0.22
505 0.21
506 0.17
507 0.17
508 0.19
509 0.18
510 0.18
511 0.18
512 0.19
513 0.23
514 0.25
515 0.24
516 0.22
517 0.19
518 0.21
519 0.2
520 0.2
521 0.19
522 0.19
523 0.19
524 0.18
525 0.17
526 0.14
527 0.15
528 0.15
529 0.17
530 0.23
531 0.24
532 0.26
533 0.28
534 0.3
535 0.29
536 0.28
537 0.27
538 0.23
539 0.24
540 0.29
541 0.33
542 0.31
543 0.3
544 0.35
545 0.31
546 0.28
547 0.28
548 0.26
549 0.26
550 0.26
551 0.28
552 0.26
553 0.27
554 0.25
555 0.24
556 0.21
557 0.22
558 0.24
559 0.26
560 0.28
561 0.34
562 0.37
563 0.45
564 0.48
565 0.49
566 0.55
567 0.54
568 0.51
569 0.47
570 0.46
571 0.39
572 0.38
573 0.33
574 0.25
575 0.23
576 0.2
577 0.18
578 0.16
579 0.14
580 0.12
581 0.09
582 0.08
583 0.07
584 0.07
585 0.06
586 0.06
587 0.06
588 0.05
589 0.04
590 0.03
591 0.04
592 0.04
593 0.03
594 0.03
595 0.04
596 0.05
597 0.07
598 0.08
599 0.08
600 0.08
601 0.09
602 0.1
603 0.13
604 0.13
605 0.11
606 0.12
607 0.14
608 0.15
609 0.16
610 0.18
611 0.17
612 0.18
613 0.19
614 0.19
615 0.17
616 0.17
617 0.17
618 0.17
619 0.16
620 0.16
621 0.16
622 0.17
623 0.17
624 0.17
625 0.16
626 0.13
627 0.16
628 0.2
629 0.2
630 0.19
631 0.2
632 0.21
633 0.26
634 0.3
635 0.27
636 0.25
637 0.26
638 0.27
639 0.27
640 0.26
641 0.25
642 0.22
643 0.27
644 0.24
645 0.26
646 0.25
647 0.25
648 0.26
649 0.23
650 0.21
651 0.16
652 0.16
653 0.15
654 0.13
655 0.12
656 0.09
657 0.09
658 0.1
659 0.1
660 0.09
661 0.07
662 0.08
663 0.17
664 0.2
665 0.26
666 0.34
667 0.37
668 0.42
669 0.47
670 0.5
671 0.45
672 0.45
673 0.41
674 0.36
675 0.41
676 0.36
677 0.32
678 0.28
679 0.25
680 0.22
681 0.2
682 0.17
683 0.12
684 0.12
685 0.11
686 0.12
687 0.14
688 0.14
689 0.16
690 0.19
691 0.17
692 0.2
693 0.22
694 0.24
695 0.26
696 0.34
697 0.34
698 0.35
699 0.37
700 0.33
701 0.31
702 0.3
703 0.26
704 0.17
705 0.15
706 0.13
707 0.14
708 0.16
709 0.16
710 0.17
711 0.18
712 0.21
713 0.23
714 0.22
715 0.24
716 0.27
717 0.29
718 0.31
719 0.33
720 0.31
721 0.35
722 0.38
723 0.34
724 0.39
725 0.44
726 0.49
727 0.56
728 0.65
729 0.69
730 0.76
731 0.84
732 0.82
733 0.8
734 0.78
735 0.73
736 0.69
737 0.66
738 0.6
739 0.52
740 0.45
741 0.41
742 0.38
743 0.39
744 0.36