Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PL91

Protein Details
Accession A0A1E3PL91    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
134-162LLRFYWKLLQTKRKKAMKLKRLNKKLQSTHydrophilic
NLS Segment(s)
PositionSequence
145-158KRKKAMKLKRLNKK
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MVSDTTSSGDDLSFKVVLNYRAGNTNNNKPLTDLSSQGELAFTDRDSLVNTTYDVNSNNMVPTTSSEISHPDLHSDIFKTDLHTLSLKQLTNLLDQVNQHLVKDFIKNGLLDLPMEEESKWKKNADLVANHLILLRFYWKLLQTKRKKAMKLKRLNKKLQST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.17
4 0.19
5 0.21
6 0.23
7 0.21
8 0.27
9 0.29
10 0.33
11 0.36
12 0.44
13 0.47
14 0.47
15 0.46
16 0.41
17 0.42
18 0.39
19 0.34
20 0.28
21 0.23
22 0.23
23 0.23
24 0.22
25 0.19
26 0.14
27 0.14
28 0.12
29 0.09
30 0.08
31 0.08
32 0.09
33 0.1
34 0.11
35 0.11
36 0.11
37 0.11
38 0.11
39 0.12
40 0.13
41 0.12
42 0.13
43 0.12
44 0.12
45 0.12
46 0.1
47 0.1
48 0.08
49 0.09
50 0.14
51 0.13
52 0.13
53 0.13
54 0.16
55 0.19
56 0.2
57 0.19
58 0.14
59 0.14
60 0.14
61 0.14
62 0.12
63 0.1
64 0.1
65 0.1
66 0.11
67 0.12
68 0.12
69 0.13
70 0.13
71 0.13
72 0.15
73 0.18
74 0.16
75 0.14
76 0.17
77 0.17
78 0.17
79 0.18
80 0.15
81 0.13
82 0.13
83 0.15
84 0.17
85 0.16
86 0.14
87 0.14
88 0.14
89 0.14
90 0.16
91 0.15
92 0.12
93 0.13
94 0.13
95 0.13
96 0.14
97 0.13
98 0.11
99 0.11
100 0.11
101 0.11
102 0.11
103 0.11
104 0.13
105 0.18
106 0.23
107 0.25
108 0.23
109 0.24
110 0.27
111 0.34
112 0.37
113 0.36
114 0.38
115 0.41
116 0.4
117 0.39
118 0.36
119 0.29
120 0.22
121 0.19
122 0.16
123 0.1
124 0.11
125 0.14
126 0.18
127 0.26
128 0.35
129 0.45
130 0.52
131 0.63
132 0.72
133 0.77
134 0.81
135 0.83
136 0.85
137 0.86
138 0.87
139 0.86
140 0.88
141 0.9
142 0.92