Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NPP3

Protein Details
Accession A0A1E3NPP3    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
50-77TDCLQQTNKQTSRKKKQRNTLSSSRRMHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 10, cyto 3, extr 3
Family & Domain DBs
Amino Acid Sequences MGSCVAARLCWGTLHVPRVLGLGPGSYMAGNGPGKNKACGAANPSTRKHTDCLQQTNKQTSRKKKQRNTLSSSRRMH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.22
4 0.21
5 0.22
6 0.2
7 0.16
8 0.12
9 0.08
10 0.07
11 0.07
12 0.07
13 0.06
14 0.06
15 0.05
16 0.08
17 0.09
18 0.1
19 0.11
20 0.15
21 0.16
22 0.17
23 0.17
24 0.15
25 0.15
26 0.15
27 0.18
28 0.21
29 0.26
30 0.3
31 0.32
32 0.35
33 0.36
34 0.36
35 0.34
36 0.32
37 0.34
38 0.37
39 0.45
40 0.49
41 0.54
42 0.58
43 0.66
44 0.67
45 0.68
46 0.7
47 0.71
48 0.75
49 0.79
50 0.84
51 0.84
52 0.88
53 0.91
54 0.91
55 0.89
56 0.89
57 0.88