Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3NN68

Protein Details
Accession A0A1E3NN68    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGKRKKSSRGPVKKLKQKLDTQFTCHydrophilic
NLS Segment(s)
PositionSequence
3-16KRKKSSRGPVKKLK
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRGPVKKLKQKLDTQFTCLFCNHEKAINCTIDKKSNIGTLTCKICGQSFQTSITSLSEPIDIYSTWIDACE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.88
3 0.84
4 0.82
5 0.82
6 0.81
7 0.73
8 0.69
9 0.66
10 0.59
11 0.53
12 0.44
13 0.38
14 0.29
15 0.31
16 0.25
17 0.24
18 0.23
19 0.26
20 0.3
21 0.29
22 0.28
23 0.27
24 0.29
25 0.28
26 0.28
27 0.25
28 0.22
29 0.22
30 0.23
31 0.2
32 0.21
33 0.2
34 0.22
35 0.22
36 0.21
37 0.18
38 0.18
39 0.19
40 0.2
41 0.21
42 0.2
43 0.22
44 0.23
45 0.23
46 0.23
47 0.23
48 0.2
49 0.15
50 0.14
51 0.13
52 0.12
53 0.12
54 0.12
55 0.1
56 0.12
57 0.12
58 0.12