Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NDH0

Protein Details
Accession A0A1E3NDH0    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-32PQLVKDRYAVRRKLHRYRMLLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18.5, cyto_nucl 13.5, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001451  Hexapep  
IPR024688  Mac_dom  
IPR011004  Trimer_LpxA-like_sf  
Gene Ontology GO:0016407  F:acetyltransferase activity  
Pfam View protein in Pfam  
PF14602  Hexapep_2  
PF12464  Mac  
CDD cd03357  LbH_MAT_GAT  
Amino Acid Sequences MIAGELYSCSDPQLVKDRYAVRRKLHRYRMLLEEKTLAEDFLHDHVFREFADCSTSFIEPPLFLDYGYNCTIGHHFYSNFNCVMLDCAEITIGNHVMFGPNVQLITATHPKDSVSRNELCQEIAKPITIGDGCWLGAGATVLPGVTLGKNCVVAAGAVVTKSFLEDGLVLVGVPAKVTERLDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.33
4 0.41
5 0.48
6 0.57
7 0.6
8 0.58
9 0.66
10 0.74
11 0.78
12 0.81
13 0.8
14 0.77
15 0.75
16 0.76
17 0.75
18 0.67
19 0.58
20 0.51
21 0.42
22 0.4
23 0.35
24 0.25
25 0.16
26 0.15
27 0.15
28 0.14
29 0.15
30 0.12
31 0.13
32 0.13
33 0.13
34 0.13
35 0.14
36 0.12
37 0.1
38 0.13
39 0.12
40 0.14
41 0.16
42 0.16
43 0.13
44 0.14
45 0.14
46 0.11
47 0.12
48 0.13
49 0.11
50 0.1
51 0.11
52 0.11
53 0.14
54 0.15
55 0.14
56 0.11
57 0.11
58 0.12
59 0.13
60 0.13
61 0.11
62 0.11
63 0.15
64 0.17
65 0.19
66 0.18
67 0.16
68 0.15
69 0.13
70 0.14
71 0.1
72 0.09
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.05
79 0.05
80 0.04
81 0.05
82 0.04
83 0.05
84 0.05
85 0.05
86 0.05
87 0.04
88 0.04
89 0.04
90 0.05
91 0.05
92 0.1
93 0.16
94 0.16
95 0.16
96 0.16
97 0.17
98 0.21
99 0.23
100 0.23
101 0.23
102 0.24
103 0.26
104 0.28
105 0.28
106 0.25
107 0.24
108 0.2
109 0.18
110 0.16
111 0.15
112 0.13
113 0.12
114 0.14
115 0.12
116 0.11
117 0.09
118 0.09
119 0.09
120 0.09
121 0.09
122 0.06
123 0.06
124 0.06
125 0.05
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.05
132 0.05
133 0.06
134 0.08
135 0.09
136 0.1
137 0.1
138 0.1
139 0.09
140 0.08
141 0.08
142 0.08
143 0.07
144 0.07
145 0.07
146 0.07
147 0.07
148 0.08
149 0.07
150 0.06
151 0.06
152 0.06
153 0.07
154 0.08
155 0.08
156 0.07
157 0.07
158 0.08
159 0.07
160 0.07
161 0.07
162 0.08
163 0.11