Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NTH2

Protein Details
Accession A0A1E3NTH2   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
59-88SAILWKRVTNRGKKRQKCENQPKRTPGRKRHydrophilic
NLS Segment(s)
PositionSequence
64-88KRVTNRGKKRQKCENQPKRTPGRKR
Subcellular Location(s) mito 7, nucl 6, plas 6, extr 5, cyto 2
Family & Domain DBs
Amino Acid Sequences MTVCYVLSEALFALFAPSLLPLSSSVFASSSSPWCSFMLPARAEALRSSPGPPIGRWPSAILWKRVTNRGKKRQKCENQPKRTPGRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.06
6 0.06
7 0.07
8 0.06
9 0.09
10 0.1
11 0.1
12 0.1
13 0.1
14 0.11
15 0.11
16 0.12
17 0.12
18 0.14
19 0.15
20 0.16
21 0.16
22 0.16
23 0.16
24 0.18
25 0.21
26 0.19
27 0.19
28 0.18
29 0.18
30 0.18
31 0.17
32 0.15
33 0.11
34 0.11
35 0.12
36 0.11
37 0.15
38 0.16
39 0.16
40 0.22
41 0.25
42 0.25
43 0.25
44 0.26
45 0.24
46 0.32
47 0.36
48 0.32
49 0.32
50 0.37
51 0.4
52 0.47
53 0.53
54 0.54
55 0.61
56 0.68
57 0.75
58 0.79
59 0.84
60 0.86
61 0.89
62 0.9
63 0.9
64 0.91
65 0.9
66 0.91
67 0.92
68 0.92