Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3NQW9

Protein Details
Accession A0A1E3NQW9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
14-38AMAPGGMTKKRQKRKRLLESRAGHVHydrophilic
67-94KREKGEQGKKAKKRKREKGEKVRVSRLSBasic
NLS Segment(s)
PositionSequence
19-29GMTKKRQKRKR
65-89TGKREKGEQGKKAKKRKREKGEKVR
Subcellular Location(s) mito 19, cyto 5, nucl 3
Family & Domain DBs
Amino Acid Sequences MSAAAAAGLNRKSAMAPGGMTKKRQKRKRLLESRAGHVMWHVSCGWERDWRTVAARHLGVWCPKTGKREKGEQGKKAKKRKREKGEKVRVSRLSAELCGAVALRQRGGIWLRWLTGRLRFSLVAKSCLPVPFHGATTNTRTNQYSHLSPLQPLATPPTLRYTTPRPAETI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.12
3 0.12
4 0.18
5 0.28
6 0.3
7 0.36
8 0.44
9 0.53
10 0.62
11 0.7
12 0.74
13 0.75
14 0.84
15 0.89
16 0.9
17 0.89
18 0.89
19 0.85
20 0.79
21 0.74
22 0.63
23 0.51
24 0.41
25 0.36
26 0.26
27 0.23
28 0.17
29 0.13
30 0.14
31 0.16
32 0.17
33 0.2
34 0.22
35 0.23
36 0.25
37 0.26
38 0.28
39 0.29
40 0.3
41 0.28
42 0.27
43 0.24
44 0.24
45 0.26
46 0.26
47 0.24
48 0.22
49 0.21
50 0.24
51 0.3
52 0.36
53 0.4
54 0.4
55 0.48
56 0.54
57 0.61
58 0.67
59 0.67
60 0.7
61 0.72
62 0.77
63 0.79
64 0.77
65 0.76
66 0.79
67 0.82
68 0.83
69 0.85
70 0.87
71 0.88
72 0.93
73 0.91
74 0.86
75 0.83
76 0.74
77 0.65
78 0.56
79 0.47
80 0.37
81 0.28
82 0.23
83 0.15
84 0.13
85 0.1
86 0.08
87 0.07
88 0.08
89 0.08
90 0.07
91 0.08
92 0.08
93 0.1
94 0.12
95 0.14
96 0.15
97 0.16
98 0.17
99 0.17
100 0.19
101 0.18
102 0.23
103 0.22
104 0.2
105 0.21
106 0.22
107 0.22
108 0.29
109 0.29
110 0.27
111 0.26
112 0.25
113 0.25
114 0.27
115 0.27
116 0.2
117 0.24
118 0.21
119 0.22
120 0.23
121 0.23
122 0.23
123 0.28
124 0.34
125 0.3
126 0.32
127 0.32
128 0.32
129 0.35
130 0.36
131 0.32
132 0.31
133 0.36
134 0.34
135 0.33
136 0.35
137 0.32
138 0.27
139 0.26
140 0.26
141 0.25
142 0.25
143 0.25
144 0.29
145 0.3
146 0.3
147 0.35
148 0.36
149 0.41
150 0.47