Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NDF2

Protein Details
Accession A0A1E3NDF2    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MTRSERKKKVECKRMRVNKQRPTNGTGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, mito_nucl 13, mito 9.5
Family & Domain DBs
Amino Acid Sequences MTRSERKKKVECKRMRVNKQRPTNGTGKISKKTEIFIGKPTPTYHMPSSLKKFLDKYATNNLLNKNSVTNVRKKKELERKTIVNGFTAFRIYYSKFGKTYKDQENLSKELATFWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.92
4 0.92
5 0.91
6 0.91
7 0.9
8 0.83
9 0.78
10 0.74
11 0.69
12 0.65
13 0.63
14 0.58
15 0.55
16 0.53
17 0.5
18 0.45
19 0.4
20 0.39
21 0.37
22 0.33
23 0.32
24 0.35
25 0.32
26 0.33
27 0.33
28 0.31
29 0.27
30 0.3
31 0.25
32 0.28
33 0.31
34 0.34
35 0.4
36 0.4
37 0.39
38 0.36
39 0.37
40 0.32
41 0.36
42 0.31
43 0.3
44 0.33
45 0.37
46 0.37
47 0.38
48 0.38
49 0.32
50 0.32
51 0.28
52 0.2
53 0.17
54 0.23
55 0.23
56 0.3
57 0.37
58 0.39
59 0.44
60 0.46
61 0.55
62 0.59
63 0.64
64 0.64
65 0.61
66 0.63
67 0.64
68 0.66
69 0.57
70 0.48
71 0.41
72 0.33
73 0.27
74 0.24
75 0.17
76 0.13
77 0.16
78 0.15
79 0.2
80 0.23
81 0.26
82 0.28
83 0.31
84 0.37
85 0.41
86 0.48
87 0.5
88 0.54
89 0.53
90 0.58
91 0.62
92 0.59
93 0.53
94 0.46
95 0.37