Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NUH0

Protein Details
Accession A0A1E3NUH0   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22KYQEKQRRRRGLQKTRFYCQVCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR019447  DNA/RNA-bd_Kin17_WH-like_dom  
IPR037321  KIN17-like  
IPR038254  KIN17_WH-like_sf  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF10357  Kin17_mid  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences KYQEKQRRRRGLQKTRFYCQVCARQCLDENGFSCHVKSDVHMRNLRKQLAGNEPGGGGATAAAALIARYSDQFAAAFLALLRRTHGDKPVALNRFYQEYIRDRDHVHLNSTRWRSVTAAARHLHAAGRCRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.83
3 0.82
4 0.75
5 0.71
6 0.68
7 0.67
8 0.61
9 0.59
10 0.55
11 0.5
12 0.49
13 0.48
14 0.42
15 0.36
16 0.33
17 0.32
18 0.32
19 0.28
20 0.26
21 0.22
22 0.2
23 0.15
24 0.15
25 0.21
26 0.25
27 0.33
28 0.38
29 0.41
30 0.48
31 0.54
32 0.55
33 0.46
34 0.41
35 0.39
36 0.41
37 0.4
38 0.32
39 0.26
40 0.24
41 0.22
42 0.2
43 0.15
44 0.07
45 0.04
46 0.03
47 0.03
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.03
56 0.04
57 0.04
58 0.04
59 0.04
60 0.05
61 0.06
62 0.05
63 0.05
64 0.05
65 0.07
66 0.07
67 0.07
68 0.08
69 0.09
70 0.12
71 0.14
72 0.19
73 0.2
74 0.21
75 0.27
76 0.34
77 0.35
78 0.33
79 0.33
80 0.3
81 0.31
82 0.3
83 0.26
84 0.23
85 0.25
86 0.29
87 0.31
88 0.32
89 0.3
90 0.33
91 0.4
92 0.37
93 0.37
94 0.37
95 0.37
96 0.44
97 0.46
98 0.44
99 0.37
100 0.37
101 0.33
102 0.35
103 0.41
104 0.37
105 0.41
106 0.4
107 0.41
108 0.4
109 0.39
110 0.37
111 0.32