Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NS09

Protein Details
Accession A0A1E3NS09    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKRSWRLSAPQKRRQRHRMQLVDSNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, mito_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRASPVSLGGLLWKRSWRLSAPQKRRQRHRMQLVDSNIDVLYEGLKANEMSSKKVEDLKNNFPRENEMKSKDKYTVFNKHARGYRKGAHFVPKWTKLSLRENPENF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.24
4 0.25
5 0.24
6 0.26
7 0.29
8 0.27
9 0.32
10 0.42
11 0.51
12 0.58
13 0.66
14 0.74
15 0.8
16 0.87
17 0.87
18 0.87
19 0.86
20 0.87
21 0.86
22 0.82
23 0.8
24 0.73
25 0.66
26 0.55
27 0.46
28 0.34
29 0.25
30 0.19
31 0.11
32 0.08
33 0.05
34 0.05
35 0.04
36 0.05
37 0.05
38 0.05
39 0.09
40 0.09
41 0.11
42 0.12
43 0.13
44 0.14
45 0.2
46 0.22
47 0.26
48 0.32
49 0.41
50 0.48
51 0.5
52 0.5
53 0.44
54 0.48
55 0.44
56 0.44
57 0.41
58 0.38
59 0.41
60 0.42
61 0.44
62 0.43
63 0.42
64 0.43
65 0.44
66 0.48
67 0.47
68 0.53
69 0.54
70 0.56
71 0.59
72 0.58
73 0.56
74 0.53
75 0.55
76 0.54
77 0.56
78 0.53
79 0.57
80 0.54
81 0.58
82 0.61
83 0.61
84 0.57
85 0.54
86 0.55
87 0.53
88 0.59
89 0.59
90 0.59