Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3NU53

Protein Details
Accession A0A1E3NU53    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
86-120GEGERKKMPGPARKNKKEKKRENRTHCRHSLPPSRBasic
NLS Segment(s)
PositionSequence
89-109ERKKMPGPARKNKKEKKRENR
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRVRKRSVLPSGERNACKDVEERSVCPGRLVQQVLTCVGDSSGGVGQQCRRLASGAGRLSMAPRGAPLLLHRPGRLCGALHLLRLGEGERKKMPGPARKNKKEKKRENRTHCRHSLPPSRGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.55
3 0.47
4 0.42
5 0.35
6 0.31
7 0.31
8 0.33
9 0.31
10 0.35
11 0.39
12 0.37
13 0.36
14 0.34
15 0.29
16 0.31
17 0.32
18 0.26
19 0.24
20 0.25
21 0.25
22 0.24
23 0.2
24 0.14
25 0.12
26 0.1
27 0.07
28 0.07
29 0.07
30 0.07
31 0.07
32 0.08
33 0.1
34 0.14
35 0.15
36 0.14
37 0.14
38 0.14
39 0.15
40 0.17
41 0.23
42 0.2
43 0.19
44 0.19
45 0.18
46 0.18
47 0.18
48 0.15
49 0.07
50 0.06
51 0.07
52 0.06
53 0.07
54 0.08
55 0.13
56 0.17
57 0.19
58 0.19
59 0.2
60 0.21
61 0.23
62 0.22
63 0.16
64 0.13
65 0.19
66 0.19
67 0.18
68 0.18
69 0.15
70 0.15
71 0.15
72 0.14
73 0.14
74 0.14
75 0.18
76 0.19
77 0.22
78 0.23
79 0.28
80 0.35
81 0.39
82 0.48
83 0.55
84 0.64
85 0.72
86 0.83
87 0.87
88 0.9
89 0.91
90 0.92
91 0.92
92 0.93
93 0.94
94 0.94
95 0.95
96 0.95
97 0.94
98 0.9
99 0.86
100 0.82
101 0.81
102 0.8