Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3NQW0

Protein Details
Accession A0A1E3NQW0    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
76-99GWRGESRRKRKVLQKKARITRTGRBasic
NLS Segment(s)
PositionSequence
71-117GAHEAGWRGESRRKRKVLQKKARITRTGRIGRVGRIRAGTAGRRHKG
Subcellular Location(s) mito 14, extr 8, plas 2, nucl 1, cyto 1, cyto_nucl 1, pero 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MVLTLSARLFCSARKNNGGVLSEESKGFFSPAPRSVSGRRHAAPRVCHFCFTTGTSEHNVVGARRRPDWPGAHEAGWRGESRRKRKVLQKKARITRTGRIGRVGRIRAGTAGRRHKGLGVDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.44
4 0.49
5 0.48
6 0.4
7 0.37
8 0.33
9 0.29
10 0.27
11 0.24
12 0.19
13 0.18
14 0.17
15 0.13
16 0.13
17 0.17
18 0.22
19 0.26
20 0.27
21 0.31
22 0.36
23 0.41
24 0.43
25 0.44
26 0.41
27 0.41
28 0.46
29 0.47
30 0.47
31 0.49
32 0.52
33 0.47
34 0.47
35 0.42
36 0.38
37 0.35
38 0.3
39 0.25
40 0.18
41 0.19
42 0.19
43 0.19
44 0.17
45 0.16
46 0.14
47 0.11
48 0.16
49 0.18
50 0.18
51 0.19
52 0.21
53 0.22
54 0.27
55 0.3
56 0.28
57 0.3
58 0.3
59 0.29
60 0.29
61 0.28
62 0.24
63 0.23
64 0.19
65 0.15
66 0.2
67 0.28
68 0.36
69 0.44
70 0.48
71 0.54
72 0.64
73 0.72
74 0.77
75 0.79
76 0.82
77 0.83
78 0.87
79 0.88
80 0.85
81 0.79
82 0.76
83 0.75
84 0.72
85 0.64
86 0.62
87 0.56
88 0.56
89 0.59
90 0.54
91 0.47
92 0.41
93 0.4
94 0.36
95 0.39
96 0.39
97 0.4
98 0.47
99 0.46
100 0.47
101 0.47
102 0.47