Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H2AUU1

Protein Details
Accession H2AUU1    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
291-328QTILYVREPKKSRPNDKHPKRKSPEKPVTKTEKKAESCHydrophilic
NLS Segment(s)
PositionSequence
299-324PKKSRPNDKHPKRKSPEKPVTKTEKK
Subcellular Location(s) nucl 7E.R. 7, cyto 5, golg 4, mito_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037654  Big1  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
KEGG kaf:KAFR_0D04940  -  
Amino Acid Sequences MCGALVQLLLCFQVLFYSCCAELVKQKDVPAILFSHKLSPGMLKYQENYESAMSLPSKSFDIIAEELLRKCNSDAIIFVNQPGLCKLDFEEFEDEFKFLRKYIKVSSTSLKFEKVSGLHQNTFQNLIDITSKECNIDRFMTLRGNNTDDFEPYIDTNKRIIVINYPPLPENDYDLRRKHIMDYDLYLRTILAQIPSPYQTVIYTSLERSLVPKEDVMNNIEVFPGLFEDLAEEEKNDRLKDEPPAPLNKFRTLYPGMSTKYISIFDSGFLEQNGQLLKAIFTSLVGYIIYQTILYVREPKKSRPNDKHPKRKSPEKPVTKTEKKAESCEAEKKRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.12
4 0.15
5 0.15
6 0.16
7 0.18
8 0.17
9 0.23
10 0.27
11 0.33
12 0.32
13 0.34
14 0.36
15 0.36
16 0.35
17 0.3
18 0.28
19 0.24
20 0.25
21 0.25
22 0.26
23 0.26
24 0.25
25 0.23
26 0.25
27 0.24
28 0.28
29 0.31
30 0.29
31 0.3
32 0.34
33 0.37
34 0.33
35 0.32
36 0.26
37 0.22
38 0.2
39 0.22
40 0.17
41 0.15
42 0.15
43 0.14
44 0.14
45 0.14
46 0.14
47 0.11
48 0.15
49 0.14
50 0.16
51 0.18
52 0.19
53 0.2
54 0.23
55 0.23
56 0.19
57 0.19
58 0.2
59 0.18
60 0.16
61 0.16
62 0.17
63 0.22
64 0.21
65 0.21
66 0.22
67 0.21
68 0.21
69 0.2
70 0.17
71 0.12
72 0.13
73 0.14
74 0.15
75 0.16
76 0.18
77 0.22
78 0.21
79 0.23
80 0.23
81 0.21
82 0.16
83 0.18
84 0.15
85 0.12
86 0.17
87 0.18
88 0.21
89 0.27
90 0.34
91 0.35
92 0.38
93 0.44
94 0.42
95 0.45
96 0.43
97 0.39
98 0.32
99 0.29
100 0.29
101 0.24
102 0.24
103 0.28
104 0.31
105 0.3
106 0.33
107 0.34
108 0.31
109 0.32
110 0.27
111 0.2
112 0.15
113 0.15
114 0.13
115 0.11
116 0.13
117 0.12
118 0.12
119 0.13
120 0.14
121 0.14
122 0.14
123 0.15
124 0.14
125 0.14
126 0.16
127 0.19
128 0.2
129 0.22
130 0.21
131 0.22
132 0.22
133 0.22
134 0.21
135 0.17
136 0.17
137 0.13
138 0.12
139 0.1
140 0.15
141 0.14
142 0.14
143 0.14
144 0.14
145 0.15
146 0.14
147 0.14
148 0.14
149 0.16
150 0.2
151 0.21
152 0.21
153 0.2
154 0.2
155 0.21
156 0.17
157 0.18
158 0.17
159 0.19
160 0.23
161 0.24
162 0.26
163 0.26
164 0.26
165 0.25
166 0.25
167 0.23
168 0.2
169 0.22
170 0.24
171 0.23
172 0.23
173 0.2
174 0.15
175 0.14
176 0.13
177 0.11
178 0.07
179 0.08
180 0.08
181 0.1
182 0.11
183 0.11
184 0.11
185 0.1
186 0.1
187 0.1
188 0.12
189 0.13
190 0.13
191 0.13
192 0.14
193 0.14
194 0.14
195 0.14
196 0.14
197 0.14
198 0.13
199 0.14
200 0.15
201 0.17
202 0.19
203 0.19
204 0.19
205 0.17
206 0.16
207 0.15
208 0.12
209 0.1
210 0.08
211 0.06
212 0.05
213 0.04
214 0.04
215 0.05
216 0.06
217 0.07
218 0.07
219 0.07
220 0.08
221 0.11
222 0.14
223 0.14
224 0.14
225 0.14
226 0.17
227 0.23
228 0.27
229 0.29
230 0.31
231 0.39
232 0.42
233 0.49
234 0.5
235 0.49
236 0.45
237 0.4
238 0.42
239 0.38
240 0.36
241 0.31
242 0.34
243 0.3
244 0.31
245 0.31
246 0.26
247 0.24
248 0.24
249 0.21
250 0.16
251 0.14
252 0.13
253 0.15
254 0.15
255 0.14
256 0.13
257 0.14
258 0.12
259 0.14
260 0.14
261 0.11
262 0.11
263 0.1
264 0.11
265 0.09
266 0.1
267 0.07
268 0.07
269 0.08
270 0.07
271 0.08
272 0.07
273 0.07
274 0.08
275 0.08
276 0.08
277 0.06
278 0.06
279 0.07
280 0.08
281 0.1
282 0.19
283 0.2
284 0.3
285 0.34
286 0.42
287 0.52
288 0.61
289 0.71
290 0.72
291 0.81
292 0.84
293 0.91
294 0.94
295 0.94
296 0.94
297 0.92
298 0.93
299 0.92
300 0.92
301 0.92
302 0.92
303 0.89
304 0.88
305 0.89
306 0.88
307 0.86
308 0.83
309 0.82
310 0.75
311 0.74
312 0.72
313 0.68
314 0.66
315 0.68