Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NFC4

Protein Details
Accession A0A1E3NFC4   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-27GDWSLRLAYKRKRRAEAKKTCPPTPTHydrophilic
NLS Segment(s)
PositionSequence
11-16KRKRRA
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 12
Family & Domain DBs
Amino Acid Sequences MGDWSLRLAYKRKRRAEAKKTCPPTPTSCVPAANLLQSQASLQIYIRPPSTQTRWPDLLPLCLARETSLRHHPKRSRLLASSSLPALLEPPWSPHWLYFGLQQIQKGFRNRLAGLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.84
3 0.87
4 0.88
5 0.87
6 0.88
7 0.86
8 0.8
9 0.73
10 0.67
11 0.63
12 0.58
13 0.53
14 0.47
15 0.43
16 0.4
17 0.38
18 0.36
19 0.3
20 0.26
21 0.21
22 0.17
23 0.14
24 0.13
25 0.12
26 0.1
27 0.09
28 0.08
29 0.07
30 0.12
31 0.14
32 0.15
33 0.16
34 0.14
35 0.16
36 0.21
37 0.25
38 0.26
39 0.28
40 0.32
41 0.34
42 0.34
43 0.36
44 0.32
45 0.29
46 0.24
47 0.21
48 0.16
49 0.14
50 0.14
51 0.1
52 0.11
53 0.12
54 0.16
55 0.25
56 0.33
57 0.36
58 0.46
59 0.5
60 0.57
61 0.64
62 0.66
63 0.62
64 0.57
65 0.58
66 0.55
67 0.52
68 0.45
69 0.36
70 0.3
71 0.24
72 0.2
73 0.16
74 0.1
75 0.1
76 0.08
77 0.12
78 0.14
79 0.17
80 0.18
81 0.17
82 0.2
83 0.2
84 0.21
85 0.21
86 0.27
87 0.31
88 0.31
89 0.33
90 0.34
91 0.38
92 0.43
93 0.44
94 0.42
95 0.41
96 0.46