Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NSU4

Protein Details
Accession A0A1E3NSU4    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
216-244TDGLYHNLKPRKTKKKRKRSAEAAADGQQHydrophilic
NLS Segment(s)
PositionSequence
224-240KPRKTKKKRKRSAEAAA
247-259GKADGAKAKDGKR
Subcellular Location(s) nucl 13, cyto_nucl 11.333, mito_nucl 9.833, cyto 8.5, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
Pfam View protein in Pfam  
PF04641  Rtf2  
Amino Acid Sequences MGNDGGTIPSRTEILSFSLKKLKGSGADAGPGGGGATLEREWVLSQMLNTYRYCRLSKEVLAAPVVSDSSGYLYNKEKVLQYLLDRKKDGGIGRDVPTIGSLNDVVQLDIKLQGNRLTCPLSGTTLDIDHDGDLKLSDVQFCYIVPCGCTVNSNILRELVEDSEQDAADRKGAGAEAVKTCPVCFTPFTLSNIIDINPQDTAGQKRLQLRIDKLKTDGLYHNLKPRKTKKKRKRSAEAAADGQQPIGKADGAKAKDGKRQKTQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.23
3 0.24
4 0.27
5 0.35
6 0.36
7 0.36
8 0.37
9 0.37
10 0.32
11 0.34
12 0.36
13 0.29
14 0.31
15 0.29
16 0.27
17 0.22
18 0.18
19 0.14
20 0.08
21 0.06
22 0.04
23 0.06
24 0.06
25 0.06
26 0.06
27 0.07
28 0.07
29 0.08
30 0.1
31 0.08
32 0.08
33 0.13
34 0.16
35 0.18
36 0.19
37 0.22
38 0.25
39 0.29
40 0.3
41 0.27
42 0.3
43 0.32
44 0.34
45 0.37
46 0.36
47 0.33
48 0.33
49 0.3
50 0.25
51 0.2
52 0.17
53 0.11
54 0.07
55 0.06
56 0.06
57 0.1
58 0.1
59 0.12
60 0.15
61 0.18
62 0.19
63 0.2
64 0.2
65 0.18
66 0.2
67 0.2
68 0.22
69 0.29
70 0.34
71 0.37
72 0.37
73 0.36
74 0.35
75 0.36
76 0.34
77 0.27
78 0.26
79 0.26
80 0.28
81 0.28
82 0.27
83 0.23
84 0.22
85 0.18
86 0.13
87 0.1
88 0.08
89 0.07
90 0.09
91 0.09
92 0.08
93 0.08
94 0.08
95 0.08
96 0.1
97 0.12
98 0.1
99 0.11
100 0.14
101 0.15
102 0.15
103 0.17
104 0.16
105 0.14
106 0.15
107 0.15
108 0.13
109 0.12
110 0.12
111 0.11
112 0.09
113 0.1
114 0.09
115 0.08
116 0.07
117 0.07
118 0.06
119 0.05
120 0.05
121 0.05
122 0.06
123 0.05
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.07
130 0.08
131 0.08
132 0.07
133 0.08
134 0.08
135 0.08
136 0.09
137 0.09
138 0.16
139 0.19
140 0.2
141 0.2
142 0.19
143 0.19
144 0.19
145 0.2
146 0.12
147 0.1
148 0.09
149 0.09
150 0.1
151 0.1
152 0.09
153 0.09
154 0.09
155 0.09
156 0.08
157 0.08
158 0.07
159 0.07
160 0.07
161 0.07
162 0.1
163 0.11
164 0.12
165 0.13
166 0.13
167 0.13
168 0.13
169 0.13
170 0.13
171 0.12
172 0.14
173 0.19
174 0.22
175 0.26
176 0.27
177 0.26
178 0.25
179 0.25
180 0.22
181 0.18
182 0.15
183 0.13
184 0.11
185 0.11
186 0.1
187 0.12
188 0.16
189 0.17
190 0.19
191 0.22
192 0.28
193 0.33
194 0.38
195 0.42
196 0.45
197 0.52
198 0.55
199 0.53
200 0.5
201 0.5
202 0.45
203 0.43
204 0.4
205 0.35
206 0.37
207 0.38
208 0.45
209 0.45
210 0.48
211 0.54
212 0.6
213 0.66
214 0.71
215 0.79
216 0.81
217 0.86
218 0.94
219 0.94
220 0.95
221 0.94
222 0.93
223 0.92
224 0.87
225 0.81
226 0.75
227 0.67
228 0.56
229 0.46
230 0.36
231 0.26
232 0.21
233 0.17
234 0.13
235 0.1
236 0.15
237 0.22
238 0.23
239 0.29
240 0.35
241 0.38
242 0.46
243 0.54
244 0.58