Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NG57

Protein Details
Accession A0A1E3NG57   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
92-114KFLHRNQCLRTQKKQKVFFWFSVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto 9, mito 4, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003120  Ste12  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF02200  STE  
Amino Acid Sequences FLATAPVNWHENQVIRRYFLNKEEGFVSCVYWNNLYFITGTDIVRCIAYKMAHIGRQIVDRKKFEEGIFSDLRALKCGTHAVLENSRSQFLKFLHRNQCLRTQKKQKVFFWFSVPHNKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.35
4 0.36
5 0.37
6 0.36
7 0.41
8 0.33
9 0.33
10 0.33
11 0.31
12 0.29
13 0.25
14 0.23
15 0.15
16 0.17
17 0.17
18 0.17
19 0.16
20 0.15
21 0.15
22 0.14
23 0.12
24 0.11
25 0.13
26 0.13
27 0.13
28 0.12
29 0.12
30 0.12
31 0.12
32 0.11
33 0.08
34 0.09
35 0.09
36 0.09
37 0.13
38 0.15
39 0.18
40 0.18
41 0.19
42 0.17
43 0.23
44 0.28
45 0.29
46 0.32
47 0.31
48 0.32
49 0.33
50 0.34
51 0.28
52 0.28
53 0.24
54 0.25
55 0.24
56 0.22
57 0.22
58 0.23
59 0.23
60 0.19
61 0.18
62 0.12
63 0.13
64 0.15
65 0.12
66 0.11
67 0.12
68 0.15
69 0.19
70 0.2
71 0.24
72 0.24
73 0.26
74 0.25
75 0.23
76 0.24
77 0.21
78 0.3
79 0.32
80 0.4
81 0.48
82 0.56
83 0.59
84 0.58
85 0.67
86 0.67
87 0.68
88 0.69
89 0.7
90 0.72
91 0.78
92 0.84
93 0.8
94 0.8
95 0.8
96 0.73
97 0.69
98 0.66
99 0.62