Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NDF7

Protein Details
Accession A0A1E3NDF7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
45-66PTKLTQHMVKRQKNQKNCRIAFHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, mito 6, E.R. 4, plas 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MICALFVCSFAQRCKKGFATYSYIKILTCSFAKSAVKLSFEQVSPTKLTQHMVKRQKNQKNCRIAFNSIAVPGDFLAAAAVFLVDFEQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.44
4 0.46
5 0.44
6 0.44
7 0.43
8 0.45
9 0.42
10 0.39
11 0.33
12 0.3
13 0.25
14 0.2
15 0.17
16 0.15
17 0.12
18 0.16
19 0.17
20 0.16
21 0.21
22 0.2
23 0.22
24 0.21
25 0.22
26 0.2
27 0.2
28 0.22
29 0.17
30 0.17
31 0.16
32 0.16
33 0.16
34 0.14
35 0.16
36 0.19
37 0.25
38 0.33
39 0.42
40 0.48
41 0.56
42 0.66
43 0.73
44 0.77
45 0.8
46 0.8
47 0.81
48 0.76
49 0.75
50 0.7
51 0.65
52 0.58
53 0.51
54 0.43
55 0.33
56 0.32
57 0.23
58 0.18
59 0.15
60 0.12
61 0.08
62 0.07
63 0.06
64 0.05
65 0.05
66 0.04
67 0.04
68 0.03
69 0.03