Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NS96

Protein Details
Accession A0A1E3NS96   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-26LVRVMPPSKRSRQNKLETQGHydrophilic
NLS Segment(s)
PositionSequence
53-55KKG
Subcellular Location(s) nucl 16, mito_nucl 12.833, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
Amino Acid Sequences MYPSQQLVRVMPPSKRSRQNKLETQGATPMPCSNVGTIKKNFIIFSMCIVRRKKGKESKELNSGACKAHEKRRHILMPSSFIRCSSSGQCFDDPAGHNVKPSSIQYHHWHLSSSISAWLTFFSPSAGLTPSHAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.63
3 0.66
4 0.69
5 0.75
6 0.8
7 0.8
8 0.78
9 0.77
10 0.68
11 0.63
12 0.58
13 0.5
14 0.41
15 0.32
16 0.27
17 0.2
18 0.2
19 0.18
20 0.14
21 0.19
22 0.23
23 0.28
24 0.28
25 0.31
26 0.33
27 0.33
28 0.31
29 0.25
30 0.25
31 0.18
32 0.2
33 0.24
34 0.24
35 0.29
36 0.31
37 0.34
38 0.37
39 0.41
40 0.47
41 0.49
42 0.54
43 0.58
44 0.63
45 0.64
46 0.67
47 0.65
48 0.56
49 0.49
50 0.44
51 0.34
52 0.28
53 0.27
54 0.21
55 0.28
56 0.34
57 0.35
58 0.38
59 0.45
60 0.47
61 0.46
62 0.49
63 0.42
64 0.42
65 0.4
66 0.4
67 0.32
68 0.29
69 0.28
70 0.23
71 0.24
72 0.21
73 0.23
74 0.23
75 0.26
76 0.26
77 0.25
78 0.24
79 0.26
80 0.24
81 0.22
82 0.24
83 0.21
84 0.21
85 0.21
86 0.21
87 0.19
88 0.19
89 0.22
90 0.2
91 0.26
92 0.3
93 0.38
94 0.4
95 0.38
96 0.37
97 0.31
98 0.32
99 0.27
100 0.23
101 0.19
102 0.17
103 0.16
104 0.16
105 0.16
106 0.14
107 0.13
108 0.12
109 0.09
110 0.08
111 0.09
112 0.1
113 0.11
114 0.1