Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NM44

Protein Details
Accession A0A1E3NM44   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
43-62AHYTRSGKRGRRKCLRHQGABasic
96-119TEARPGRPGCRERRFRWWRRVQWSHydrophilic
NLS Segment(s)
PositionSequence
49-104GKRGRRKCLRHQGAAAAKNFRRSTQKALIRVDRRKFGRDRRVGDGPVTEARPGRPG
106-108RER
Subcellular Location(s) mito 18, cyto_nucl 3, pero 3, nucl 2.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MFVRGGVCGGRNFQTAESCAALRTLKYCVREQIGSFQCTPVFAHYTRSGKRGRRKCLRHQGAAAAKNFRRSTQKALIRVDRRKFGRDRRVGDGPVTEARPGRPGCRERRFRWWRRVQWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.23
4 0.22
5 0.19
6 0.18
7 0.18
8 0.18
9 0.15
10 0.15
11 0.17
12 0.19
13 0.22
14 0.25
15 0.28
16 0.31
17 0.32
18 0.32
19 0.37
20 0.37
21 0.36
22 0.34
23 0.31
24 0.27
25 0.25
26 0.24
27 0.17
28 0.16
29 0.13
30 0.18
31 0.22
32 0.28
33 0.29
34 0.33
35 0.37
36 0.41
37 0.51
38 0.55
39 0.6
40 0.64
41 0.7
42 0.76
43 0.81
44 0.8
45 0.74
46 0.66
47 0.64
48 0.6
49 0.57
50 0.48
51 0.43
52 0.37
53 0.4
54 0.39
55 0.34
56 0.34
57 0.33
58 0.38
59 0.42
60 0.47
61 0.46
62 0.52
63 0.58
64 0.6
65 0.66
66 0.63
67 0.61
68 0.58
69 0.59
70 0.61
71 0.63
72 0.65
73 0.65
74 0.65
75 0.64
76 0.67
77 0.62
78 0.56
79 0.47
80 0.4
81 0.35
82 0.31
83 0.26
84 0.22
85 0.21
86 0.26
87 0.26
88 0.27
89 0.32
90 0.39
91 0.48
92 0.57
93 0.66
94 0.65
95 0.74
96 0.81
97 0.82
98 0.85
99 0.85