Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3NJE7

Protein Details
Accession A0A1E3NJE7    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
60-79LQRKEKNKLLEEKKKKREEEBasic
NLS Segment(s)
PositionSequence
63-76KEKNKLLEEKKKKR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHPILDRDRFQNCEDLIDALEECHRSPFFETVLGKCSDVKIQLSQCLHENRLANDRLQILQRKEKNKLLEEKKKKREEEEWGENGYLKKVVELEYQKRMQQQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.26
3 0.22
4 0.2
5 0.18
6 0.12
7 0.14
8 0.12
9 0.11
10 0.13
11 0.13
12 0.13
13 0.15
14 0.17
15 0.15
16 0.2
17 0.21
18 0.19
19 0.23
20 0.23
21 0.21
22 0.19
23 0.19
24 0.16
25 0.16
26 0.16
27 0.16
28 0.17
29 0.21
30 0.22
31 0.22
32 0.24
33 0.25
34 0.25
35 0.24
36 0.24
37 0.21
38 0.25
39 0.25
40 0.21
41 0.2
42 0.2
43 0.18
44 0.2
45 0.24
46 0.23
47 0.3
48 0.36
49 0.39
50 0.44
51 0.48
52 0.5
53 0.5
54 0.57
55 0.58
56 0.63
57 0.7
58 0.75
59 0.8
60 0.83
61 0.8
62 0.75
63 0.72
64 0.71
65 0.7
66 0.68
67 0.61
68 0.55
69 0.53
70 0.49
71 0.43
72 0.34
73 0.26
74 0.17
75 0.15
76 0.14
77 0.16
78 0.22
79 0.29
80 0.34
81 0.41
82 0.44
83 0.46