Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NMW0

Protein Details
Accession A0A1E3NMW0   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
167-202GRNLHIRRRRCRMETRPRLFPRPRPGPRPRPRPGLPBasic
NLS Segment(s)
PositionSequence
166-199SGRNLHIRRRRCRMETRPRLFPRPRPGPRPRPRP
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
Amino Acid Sequences MMYLVIPTKQRTRSYENLNLKKWPFFRNLVLARKFTMGTFPNVIKRPGQEGVLHRNVTDHIREKRWTQWPTSLSCSALLYSALSPVRCFSVLFSQACSLTPPLHTSAAAAALPQLTTFSMGSSLIQDPARLHARPSVTSKSIPVQAPQSVQAHSAEATVKPFRPHSGRNLHIRRRRCRMETRPRLFPRPRPGPRPRPRPGLPLWGEEWVAGQMAALGDSSRTRENVHYGHRPGPVEKSKTLLLYAVLGAAVSAVWSYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.69
3 0.73
4 0.74
5 0.72
6 0.73
7 0.67
8 0.66
9 0.61
10 0.57
11 0.52
12 0.48
13 0.49
14 0.51
15 0.57
16 0.59
17 0.59
18 0.55
19 0.51
20 0.48
21 0.43
22 0.34
23 0.32
24 0.25
25 0.25
26 0.27
27 0.28
28 0.34
29 0.36
30 0.37
31 0.33
32 0.33
33 0.34
34 0.32
35 0.31
36 0.29
37 0.32
38 0.39
39 0.43
40 0.41
41 0.36
42 0.35
43 0.34
44 0.32
45 0.32
46 0.31
47 0.3
48 0.35
49 0.37
50 0.39
51 0.46
52 0.52
53 0.5
54 0.46
55 0.48
56 0.46
57 0.48
58 0.51
59 0.44
60 0.35
61 0.33
62 0.29
63 0.22
64 0.19
65 0.15
66 0.1
67 0.08
68 0.11
69 0.12
70 0.11
71 0.11
72 0.11
73 0.13
74 0.12
75 0.12
76 0.1
77 0.16
78 0.21
79 0.21
80 0.22
81 0.21
82 0.21
83 0.21
84 0.21
85 0.15
86 0.11
87 0.11
88 0.11
89 0.13
90 0.13
91 0.13
92 0.11
93 0.11
94 0.11
95 0.1
96 0.08
97 0.06
98 0.06
99 0.06
100 0.05
101 0.05
102 0.04
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.06
109 0.07
110 0.08
111 0.09
112 0.09
113 0.09
114 0.09
115 0.13
116 0.16
117 0.14
118 0.14
119 0.16
120 0.17
121 0.19
122 0.23
123 0.24
124 0.22
125 0.23
126 0.24
127 0.23
128 0.26
129 0.24
130 0.21
131 0.2
132 0.2
133 0.2
134 0.22
135 0.21
136 0.17
137 0.17
138 0.16
139 0.14
140 0.12
141 0.12
142 0.1
143 0.09
144 0.12
145 0.13
146 0.14
147 0.15
148 0.16
149 0.19
150 0.23
151 0.26
152 0.31
153 0.38
154 0.42
155 0.51
156 0.6
157 0.65
158 0.67
159 0.74
160 0.73
161 0.74
162 0.76
163 0.72
164 0.74
165 0.75
166 0.79
167 0.81
168 0.79
169 0.8
170 0.78
171 0.81
172 0.77
173 0.75
174 0.74
175 0.73
176 0.75
177 0.74
178 0.79
179 0.81
180 0.85
181 0.87
182 0.83
183 0.82
184 0.78
185 0.75
186 0.69
187 0.68
188 0.61
189 0.54
190 0.49
191 0.41
192 0.38
193 0.3
194 0.26
195 0.16
196 0.13
197 0.09
198 0.07
199 0.06
200 0.06
201 0.06
202 0.05
203 0.05
204 0.05
205 0.07
206 0.1
207 0.11
208 0.12
209 0.15
210 0.17
211 0.24
212 0.29
213 0.35
214 0.41
215 0.44
216 0.48
217 0.51
218 0.5
219 0.47
220 0.5
221 0.52
222 0.48
223 0.45
224 0.44
225 0.42
226 0.41
227 0.39
228 0.31
229 0.23
230 0.19
231 0.18
232 0.14
233 0.11
234 0.09
235 0.08
236 0.07
237 0.06
238 0.04