Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3NMQ2

Protein Details
Accession A0A1E3NMQ2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
58-82RSPRTRLPLSPRQQCRQRRLPCWLYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 3, plas 2, cyto_nucl 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MMPRRVAVLSIYIHNEPTRFIFMFIVYQYTPYVRTYVRTYVRAELSLPRILCACVYFRSPRTRLPLSPRQQCRQRRLPCWLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.18
4 0.19
5 0.2
6 0.17
7 0.18
8 0.16
9 0.16
10 0.18
11 0.16
12 0.17
13 0.12
14 0.12
15 0.12
16 0.11
17 0.12
18 0.11
19 0.13
20 0.1
21 0.13
22 0.15
23 0.22
24 0.25
25 0.26
26 0.28
27 0.29
28 0.3
29 0.27
30 0.25
31 0.21
32 0.21
33 0.21
34 0.19
35 0.16
36 0.16
37 0.16
38 0.15
39 0.13
40 0.12
41 0.1
42 0.14
43 0.17
44 0.21
45 0.29
46 0.31
47 0.36
48 0.41
49 0.45
50 0.47
51 0.52
52 0.58
53 0.59
54 0.67
55 0.7
56 0.72
57 0.77
58 0.8
59 0.81
60 0.81
61 0.82
62 0.79