Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NTL2

Protein Details
Accession A0A1E3NTL2   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-77IIPFYQRRHEKKWKKFNSEKVCQLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito_nucl 10, cyto 8, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007201  Mei2-like_Rrm_C  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF04059  RRM_2  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MIKNIPNKVKHEELKDFIDATNFGDYQFLYLRIDFENHCNVGYAFVSFKDPLNIIPFYQRRHEKKWKKFNSEKVCQLAYAKVQGMSNLIYKFKDSKVMSNNPNYRPRIYHTDGAFIGQEMPFPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.53
3 0.47
4 0.38
5 0.34
6 0.26
7 0.21
8 0.2
9 0.16
10 0.14
11 0.13
12 0.13
13 0.13
14 0.14
15 0.13
16 0.11
17 0.11
18 0.12
19 0.12
20 0.14
21 0.13
22 0.15
23 0.19
24 0.18
25 0.18
26 0.17
27 0.16
28 0.16
29 0.15
30 0.12
31 0.08
32 0.08
33 0.1
34 0.1
35 0.1
36 0.1
37 0.1
38 0.1
39 0.14
40 0.14
41 0.12
42 0.19
43 0.21
44 0.22
45 0.28
46 0.35
47 0.37
48 0.45
49 0.56
50 0.59
51 0.67
52 0.76
53 0.79
54 0.8
55 0.83
56 0.85
57 0.84
58 0.81
59 0.76
60 0.69
61 0.6
62 0.5
63 0.44
64 0.35
65 0.27
66 0.22
67 0.17
68 0.15
69 0.14
70 0.14
71 0.14
72 0.13
73 0.16
74 0.15
75 0.15
76 0.14
77 0.16
78 0.19
79 0.18
80 0.26
81 0.23
82 0.29
83 0.36
84 0.44
85 0.49
86 0.56
87 0.63
88 0.61
89 0.68
90 0.65
91 0.6
92 0.55
93 0.55
94 0.54
95 0.52
96 0.52
97 0.45
98 0.47
99 0.44
100 0.43
101 0.37
102 0.28
103 0.24
104 0.17