Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3NHD4

Protein Details
Accession A0A1E3NHD4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
416-436DLIEISKLERRKRRFGKERNSBasic
NLS Segment(s)
PositionSequence
424-434ERRKRRFGKER
Subcellular Location(s) plas 5extr 5E.R. 5, golg 4, mito 3, vacu 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029044  Nucleotide-diphossugar_trans  
Pfam View protein in Pfam  
PF03452  Anp1  
Amino Acid Sequences MLLALCVAFAVFFIALRTPTAGTEVNVLYERKQAKDGAKSSETTAVPKLHALATPPNQDAELPDNVEFYDLHDYEGTPKGKENEEIVLLLVPLRNAEKVLPLMFRNMMNITYNHNLIDIAFLVSDCSEGDHTLEALYEYTTAMQEGKLLPILEAKELQTKGKGVFGSSDLYLKYMPQDYVEQVKKAYSPPYHSEYEKPFRSIQIYEKDFGQVIGQGFSDRHDVKIQGIRRKLMGRARNWLLSTALKPYHSWVYWRDVDIEMSPGDILEFMMNFAGGYDVIVPNVWRPLPTFLGREQPYDLNSWIESEDGLKLAETLDEDDVIVEGYAEYSTWRAHLAYIRDAKGSPNEVVELDGVGGVSILSKASVFRHGSNFPAFTFMNHAETEAFGKMTKRMGMHVGGLPHYTIWHIYEPSEDDLIEISKLERRKRRFGKERNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.12
5 0.11
6 0.12
7 0.15
8 0.16
9 0.14
10 0.19
11 0.18
12 0.19
13 0.21
14 0.22
15 0.2
16 0.26
17 0.29
18 0.26
19 0.29
20 0.32
21 0.36
22 0.45
23 0.48
24 0.49
25 0.49
26 0.48
27 0.47
28 0.49
29 0.43
30 0.37
31 0.37
32 0.31
33 0.29
34 0.29
35 0.28
36 0.22
37 0.22
38 0.23
39 0.26
40 0.3
41 0.35
42 0.35
43 0.33
44 0.32
45 0.31
46 0.3
47 0.26
48 0.22
49 0.19
50 0.19
51 0.18
52 0.18
53 0.19
54 0.16
55 0.14
56 0.19
57 0.16
58 0.18
59 0.18
60 0.18
61 0.21
62 0.29
63 0.27
64 0.2
65 0.24
66 0.26
67 0.28
68 0.3
69 0.28
70 0.24
71 0.24
72 0.23
73 0.2
74 0.17
75 0.15
76 0.13
77 0.12
78 0.08
79 0.08
80 0.09
81 0.09
82 0.09
83 0.1
84 0.11
85 0.13
86 0.15
87 0.17
88 0.16
89 0.19
90 0.2
91 0.2
92 0.2
93 0.18
94 0.18
95 0.17
96 0.17
97 0.2
98 0.2
99 0.21
100 0.18
101 0.18
102 0.16
103 0.14
104 0.14
105 0.09
106 0.07
107 0.06
108 0.06
109 0.06
110 0.06
111 0.06
112 0.05
113 0.06
114 0.06
115 0.06
116 0.07
117 0.07
118 0.07
119 0.07
120 0.07
121 0.06
122 0.06
123 0.06
124 0.05
125 0.05
126 0.06
127 0.05
128 0.06
129 0.06
130 0.05
131 0.07
132 0.07
133 0.08
134 0.09
135 0.09
136 0.09
137 0.12
138 0.12
139 0.12
140 0.12
141 0.13
142 0.17
143 0.18
144 0.19
145 0.17
146 0.18
147 0.18
148 0.2
149 0.19
150 0.14
151 0.14
152 0.15
153 0.15
154 0.14
155 0.15
156 0.11
157 0.12
158 0.11
159 0.1
160 0.11
161 0.11
162 0.1
163 0.1
164 0.12
165 0.13
166 0.21
167 0.22
168 0.21
169 0.2
170 0.2
171 0.2
172 0.2
173 0.25
174 0.19
175 0.23
176 0.26
177 0.31
178 0.33
179 0.33
180 0.36
181 0.37
182 0.42
183 0.39
184 0.37
185 0.33
186 0.32
187 0.33
188 0.3
189 0.29
190 0.3
191 0.3
192 0.28
193 0.28
194 0.27
195 0.24
196 0.22
197 0.17
198 0.11
199 0.09
200 0.09
201 0.08
202 0.08
203 0.08
204 0.09
205 0.13
206 0.11
207 0.12
208 0.12
209 0.13
210 0.15
211 0.21
212 0.25
213 0.27
214 0.29
215 0.29
216 0.3
217 0.32
218 0.35
219 0.37
220 0.38
221 0.34
222 0.39
223 0.41
224 0.41
225 0.39
226 0.35
227 0.29
228 0.25
229 0.23
230 0.2
231 0.19
232 0.16
233 0.16
234 0.18
235 0.2
236 0.18
237 0.2
238 0.18
239 0.23
240 0.24
241 0.25
242 0.25
243 0.21
244 0.21
245 0.19
246 0.18
247 0.12
248 0.1
249 0.09
250 0.07
251 0.06
252 0.05
253 0.05
254 0.04
255 0.04
256 0.04
257 0.04
258 0.04
259 0.04
260 0.03
261 0.04
262 0.03
263 0.03
264 0.04
265 0.05
266 0.05
267 0.05
268 0.05
269 0.06
270 0.08
271 0.08
272 0.07
273 0.09
274 0.13
275 0.17
276 0.19
277 0.21
278 0.21
279 0.3
280 0.3
281 0.31
282 0.3
283 0.27
284 0.26
285 0.26
286 0.25
287 0.17
288 0.16
289 0.15
290 0.13
291 0.11
292 0.1
293 0.09
294 0.08
295 0.07
296 0.07
297 0.06
298 0.06
299 0.06
300 0.06
301 0.06
302 0.07
303 0.07
304 0.07
305 0.07
306 0.07
307 0.07
308 0.07
309 0.06
310 0.04
311 0.03
312 0.04
313 0.04
314 0.04
315 0.04
316 0.05
317 0.06
318 0.06
319 0.07
320 0.07
321 0.09
322 0.14
323 0.17
324 0.24
325 0.3
326 0.31
327 0.32
328 0.32
329 0.32
330 0.32
331 0.32
332 0.25
333 0.2
334 0.2
335 0.18
336 0.19
337 0.17
338 0.12
339 0.09
340 0.08
341 0.07
342 0.05
343 0.05
344 0.04
345 0.04
346 0.04
347 0.04
348 0.04
349 0.04
350 0.06
351 0.08
352 0.15
353 0.18
354 0.21
355 0.27
356 0.28
357 0.32
358 0.35
359 0.35
360 0.28
361 0.3
362 0.26
363 0.22
364 0.26
365 0.24
366 0.23
367 0.21
368 0.22
369 0.18
370 0.19
371 0.2
372 0.15
373 0.14
374 0.12
375 0.14
376 0.15
377 0.18
378 0.21
379 0.2
380 0.22
381 0.25
382 0.26
383 0.28
384 0.29
385 0.28
386 0.26
387 0.26
388 0.24
389 0.19
390 0.18
391 0.15
392 0.13
393 0.13
394 0.16
395 0.16
396 0.16
397 0.2
398 0.22
399 0.25
400 0.24
401 0.21
402 0.17
403 0.18
404 0.18
405 0.15
406 0.12
407 0.1
408 0.15
409 0.21
410 0.3
411 0.38
412 0.45
413 0.56
414 0.66
415 0.76
416 0.82