Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NEW7

Protein Details
Accession A0A1E3NEW7   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
25-44HKKVAFRKTTPQQQQKDKADHydrophilic
105-126LAWKRRELDRLHRDRNRRIAREBasic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 14.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR009730  MFAP1_C  
Pfam View protein in Pfam  
PF06991  MFAP1  
Amino Acid Sequences MVSSGSDSDSDSGSGSSGSDEPTFHKKVAFRKTTPQQQQKDKADAPAGVAPTLEDVAVSSINRNLKRLEREQLHRAFQDSLVLDERVLCEAVDDADVPDDAVELLAWKRRELDRLHRDRNRRIAREEGGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.09
4 0.08
5 0.1
6 0.1
7 0.11
8 0.15
9 0.22
10 0.24
11 0.22
12 0.25
13 0.28
14 0.36
15 0.45
16 0.49
17 0.45
18 0.53
19 0.62
20 0.69
21 0.75
22 0.76
23 0.74
24 0.76
25 0.82
26 0.78
27 0.76
28 0.67
29 0.59
30 0.52
31 0.44
32 0.36
33 0.29
34 0.24
35 0.16
36 0.15
37 0.12
38 0.1
39 0.1
40 0.07
41 0.04
42 0.04
43 0.04
44 0.05
45 0.05
46 0.05
47 0.08
48 0.13
49 0.13
50 0.15
51 0.16
52 0.2
53 0.25
54 0.28
55 0.32
56 0.33
57 0.39
58 0.45
59 0.48
60 0.46
61 0.42
62 0.4
63 0.34
64 0.28
65 0.26
66 0.19
67 0.16
68 0.15
69 0.15
70 0.13
71 0.12
72 0.13
73 0.1
74 0.1
75 0.08
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.05
82 0.06
83 0.06
84 0.06
85 0.05
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.06
92 0.12
93 0.13
94 0.13
95 0.18
96 0.2
97 0.26
98 0.31
99 0.41
100 0.47
101 0.57
102 0.67
103 0.71
104 0.77
105 0.8
106 0.85
107 0.84
108 0.8
109 0.75
110 0.72