Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3NLS8

Protein Details
Accession A0A1E3NLS8    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-30HTDLIRRHRRILRQRLKKLNERNGTRBasic
NLS Segment(s)
PositionSequence
12-22HRRILRQRLKK
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences MASVHTDLIRRHRRILRQRLKKLNERNGTRYRLGQKNIDLLFYLNYIRFAEALATKAKQMAVIEGSSEVMHQHWQESGNELLETFANENRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.77
3 0.77
4 0.79
5 0.86
6 0.88
7 0.88
8 0.87
9 0.87
10 0.86
11 0.84
12 0.8
13 0.78
14 0.75
15 0.72
16 0.64
17 0.6
18 0.58
19 0.55
20 0.52
21 0.48
22 0.43
23 0.45
24 0.43
25 0.37
26 0.29
27 0.22
28 0.19
29 0.16
30 0.14
31 0.07
32 0.08
33 0.08
34 0.07
35 0.07
36 0.06
37 0.07
38 0.07
39 0.08
40 0.09
41 0.09
42 0.09
43 0.11
44 0.11
45 0.1
46 0.1
47 0.1
48 0.1
49 0.1
50 0.1
51 0.1
52 0.1
53 0.09
54 0.09
55 0.07
56 0.06
57 0.09
58 0.09
59 0.09
60 0.1
61 0.13
62 0.13
63 0.16
64 0.18
65 0.17
66 0.16
67 0.15
68 0.15
69 0.13
70 0.14
71 0.13