Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H2AR44

Protein Details
Accession H2AR44    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
57-85FGFLSRAKSKQKSKILKDRKEKGRWYLSHHydrophilic
NLS Segment(s)
PositionSequence
51-80LKRKRKFGFLSRAKSKQKSKILKDRKEKGR
Subcellular Location(s) mito 18, nucl 8, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:0016020  C:membrane  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG kaf:KAFR_0B05490  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLPIIKTNRNTSIFKSVILNTVQSTNVFFILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRWYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.33
4 0.32
5 0.3
6 0.27
7 0.18
8 0.19
9 0.19
10 0.15
11 0.15
12 0.12
13 0.11
14 0.1
15 0.09
16 0.08
17 0.09
18 0.09
19 0.1
20 0.1
21 0.13
22 0.2
23 0.24
24 0.3
25 0.33
26 0.4
27 0.42
28 0.5
29 0.57
30 0.6
31 0.64
32 0.6
33 0.63
34 0.59
35 0.6
36 0.61
37 0.59
38 0.6
39 0.58
40 0.65
41 0.59
42 0.66
43 0.68
44 0.69
45 0.71
46 0.71
47 0.75
48 0.72
49 0.8
50 0.77
51 0.78
52 0.77
53 0.75
54 0.76
55 0.77
56 0.79
57 0.81
58 0.84
59 0.86
60 0.88
61 0.89
62 0.89
63 0.88
64 0.86
65 0.84